Allele Report for DPB1*01:01:03

DPB1*01:01:03 View HGVS Report
Pre-2010 Nomenclature: DPB1*010103 Local Names: HLA-DBP1*01var
IMGT/HLA Acc No: HLA02006 OMIM Entry: *142858
Assigned: 2004-09-27 Sequence Last Modified: 2004-10-08
Source Entries: AJ810847  
Cells Sequence Derived From: SJ215/04  
Known Ethnic Origin Of Source: Unknown
Publications
Ludajic K et al. Tissue Antigens 67:255-6 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (88 aa)
ENYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELD
EAVTLQRR
Nucleotide Sequence Data (267 bps)
CAGAGAATTACGTGTACCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTAC
AACCGGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGA
GTACTGGAACAGCCAGAAGGACATCTTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGG
ACGAGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo