Allele Report for DPA1*02:04

DPA1*02:04 View HGVS Report
Pre-2010 Nomenclature: DPA1*0204 Local Names: HLA-DPA1
IMGT/HLA Acc No: HLA03187 OMIM Entry: *142880
Assigned: 2007-12-20 Sequence Last Modified: 2008-01-11
Source Entries: EU304462  
Cells Sequence Derived From: DP56  
Known Ethnic Origin Of Source: Oriental
Publications
Zhao H et al. Tissue Antigens 71:577-8 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (81 aa)
DHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNDLNTLIQRSNHTQAA
N
Nucleotide Sequence Data (246 bps)
CGGACCATGTGTCAACTTATGCCATGTTTGTACAGACCCATAGACCAACAGGAGAGTTTATGTTTGAATTTGATGAAGAT
GAGCAGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGCCGAGCCTTTTCCTTTGAGGC
TCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACGACTTGAATACCTTGATCCAGCGTTCCAACCACACTCAGGCCG
CCAATG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo