Allele Report for DPA1*02:01:07

DPA1*02:01:07 View HGVS Report
Pre-2010 Nomenclature: DPA1*020107 Local Names: 2840new
IMGT/HLA Acc No: HLA03999 OMIM Entry: *142880
Assigned: 2009-07-31 Sequence Last Modified: 2010-04-01
Source Entries: GQ374477  
Cells Sequence Derived From: 2840  
Known Ethnic Origin Of Source: Black
Publications
Czarnecki C et al. Human Immunology 71:733-735 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (81 aa)
DHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAA
N
Nucleotide Sequence Data (246 bps)
CGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACCCATAGACCAACAGGGGAGTTTATGTTTGAATTTGATGAAGAT
GAGCAGTTCTATGTGGATCTGGATAAAAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGCCGAGCCTTTTCCTTTGAGGC
TCAGGGTGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCGTTCCAACCACACTCAGGCCG
CCAATG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo