Allele Report for DPA1*01:03:01:05

DPA1*01:03:01:05 View HGVS Report
Pre-2010 Nomenclature: Local Names: DPA1*01:03:01:05
IMGT/HLA Acc No: HLA06606 OMIM Entry: *142880
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: CR759795 , CR759904  
Cells Sequence Derived From: APD  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (260 aa)
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFG
QAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVT
EGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL
Nucleotide Sequence Data (783 bps)
ATGCGCCCTGAAGACAGAATGTTCCATATCAGAGCTGTGATCTTGAGAGCCCTCTCCTTGGCTTTCCTGCTGAGTCTCCG
AGGAGCTGGGGCCATCAAGGCGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACGCATAGACCAACAGGGGAGTTTA
TGTTTGAATTTGATGAAGATGAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGC
CAAGCCTTTTCCTTTGAGGCTCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCG
TTCCAACCACACTCAGGCCACCAACGATCCCCCTGAGGTGACCGTGTTTCCCAAGGAGCCTGTGGAGCTGGGCCAGCCCA
ACACCCTCATCTGCCACATTGACAAGTTCTTCCCACCAGTGCTCAACGTCACGTGGCTGTGCAACGGGGAGCTGGTCACT
GAGGGTGTCGCTGAGAGCCTCTTCCTGCCCAGAACAGATTACAGCTTCCACAAGTTCCATTACCTGACCTTTGTGCCCTC
AGCAGAGGACTTCTATGACTGCAGGGTGGAGCACTGGGGCTTGGACCAGCCGCTCCTCAAGCACTGGGAGGCCCAAGAGC
CAATCCAGATGCCTGAGACAACGGAGACTGTGCTCTGTGCCCTGGGCCTGGTGCTGGGCCTAGTCGGCATCATCGTGGGC
ACCGTCCTCATCATAAAGTCTCTGCGTTCTGGCCATGACCCCCGGGCCCAGGGGACCCTGTGA
Genomic Sequence Data (9757 bps)
GGTGGACCTGAAAGAAAGATTAATTATATATTTTATTAGATAGCACATTCATTCTTAATTATCAGCAGAATATTTTTGTA
AAATATTGACAACATAACATAAAACATGATTTAAAATATAGTGACCAAAAAACATCAAAGATCATCTGACTGTCTGGGAT
GGGGGTGGGGCTCGGGAGAAGGAACATAATGGAAAACATTTGCCGTCAGAAGAAGGTGTAACTTATCTTTTTACATCTCT
TTCTCTAACTCTGAAAATGAACTGTGAACTGGAGCTCTCTTGACCACGCTGGTACCTAAAATTCTCCCATCTCTTCCCCA
GCACCTTCCAGCGTCCTCTTTACCCAGCAACAGAGAATGTCAGCTCTATGATTTCTCTGATAGGTGAATCCCAGCCATGC
TGATTCCTCTCCACCCATTTCCAGTGCTAGAGGCCCACAGTTTCAGTCTCATCTGCCTCCACTCGGCCTCAGTTCCTCAT
CACTGTTCCTGTGCTCACAGTCATCAATTATAGACCCCACAACATGCGCCCTGAAGACAGAATGTTCCATATCAGAGCTG
TGATCTTGAGAGCCCTCTCCTTGGCTTTCCTGCTGAGTCTCCGAGGAGCTGGGGCCATCAAGGGTGAGTGCTCAGGAGGA
CGCAGGAGCGTCGGGGTGAGTGATTGCTGCTTCAGGGATCACAGATTTTAGGGGCTCATTGATCTATCTGGTCCTCATAG
TCTATGTTCCCTCTGGCCCTCATAATAATAACAGCAATAACAGCCAGAATTTATGAGACTCCTGCATAGTTTCTTTCCCC
ATTTACATCTCACAGGAATCTTCAATGAAGATAATATTCCATTCATTTAGAAATTATTCCTTTTATTTAGAAATTATTTT
GAAAAAACTGAAGCTCAAAAAGATGAATAAGTTTTCCAAGGTTACACAGCAGATCAACGAGCCAAGTTTGAAGTCCAGAC
CCAGCTCTGAGGGTCATACACTGCCTTCCCCAGATTCCTGCACACAGTGACCTACTATCAGGGCCCTCCTATCTCTCTGG
GATCCCCAGCCTCTATCTTTTGTGGCTGCTTTACAGGAACTCCGAGCTATGGACTCTGCATTAGGAGACGAAGTGCAAAG
AGTGTTTCTGTATCCTCCCTCTCTTCTAGGACCCTAGGGCTCTTCCTGGGTCTTTGTGGGTGGTCACAAGCTTTCCTCTC
TCAAGACAGCAGGGTTGCATGGTCTTGATAGCCTTGTGATTCGGGTTCTGAGAGATTCAGGACTGCAAGGGAGGCCTAGA
CTTTTGATAGCTGCAAGGACTCAGCCAGAGATGGACCGTAGTGAATGCTCCTTTTTCCTGTAGCTGAAATCAGGGAGAAT
GACATCAAGCCTGTGCATGATGCTGTCATTCCAAAATCTAGTGATGGGGAAGGTTAGAATCCATAACGTACAAGATGCAC
ACTGGCTTCAGACAGTTTTATTTAAGATGTGTAGAATAAAGAGGAGGTCAGGCTGGGTAGAACCAGAAGTATCTATTGCC
CTGTTCGCGGTCACCTGAGTTATTTCTAATGTTATGTTATAATAAACACCACAATAGGCTTCTCTTCATAGATGCAAATA
CTTTTTAGTATTCTTGGTAGAAATTCCTAATGAGCTCAGCTGTCTCTTCAGGGCTTCCCTGCCCAGTCTCTTAACATTTA
AACATGTCATTTACCTTAAAAACATAAGTGCAAACCAACTGATAAAAAACAACCTTGCCTTCAGTCTGCATCCTGTCCCA
GAGACACTTTCTTTGTGTCCTCACACGTGGAGCTAAGCTTCTGACTTGTCTCTGGTACATCCCTGAGGATCCTCTCATCT
TGGCCATCAGGAACCTCTACAGAAGGTCAAATTCAGTGGGTTCTTCTCAGTGCCTCTGACTTGAGTTACTAATAACATTT
GCACTATAATCCACTTCTTTCTGATGAACTACCCTGTCCTTATTTTTCTCCTGTTTACCTGGATCCTCCTTATCATCTTT
TAAACCACCTCTTAACTATCATGTTCTCTCATTATACCCTGAGATCTCGGCAATTCTGATTTTTGGCACTCTTCCTGGAA
AATCTTATTTAACCTGCACCTGCCACTAATGACTCTCAGTTCTATGGCCTAAATTCCTCTCCTGAGACCACCCATAATCC
ACAAATATCTATGTATTATTTCTCCTTAGATGACTTTCAGGTCTTCTAAGTGCAATAGCCCCACAGTAAACTCAGTATCT
TCTCCCGGTCAGGCTGTCTTCCCTGAGAGAAGTGGCTTTTGCCCTGTTTTCTGAATGCCTACATTGAAGCCATCTGTACC
CCAGGAAGCCTTCCCTGATGTGCTGTTTGGTCGCATCTTGTGTATACCTACGTATCTGCACTTATCCTTCTGAACCTGCT
GTTGTCCTGTCACTTGTGTTTCCTTCTGTGACTTATACGCGTCTGCAGAACAGGACGTATGTATTATTTTTATTTGGGTA
TTTAGCATCTAACAGTGTTTGACATATAGTAGTCTTTTAATACATATTTTTGTCTGAATGGAAATGATATTTTGAAGAAA
AATAATCTGTTCCATAGCTGGCTGATCTTTGGACTGCAGAACTTGTGAAAGTGTTTTTTAAAAAGCATTTTAAAAAGTAC
AAGGGACATTCATGTATTAAGAAGATGAGTTTCCAATAACTGCTAGAGGACTTTGTGTCTTTTTATTTTACCCTCTTTTT
CCTGATGAGTCCTTTGAGTCCTTTAAACTGAGGAGCAAGCTAAGTTTCCTAGTGAAATACCTATAGGATTTGTTTTGTTT
AGTTTCAAATACCACTCTTTGCTTGGCCACTTACTGTGTCAGGGAGTCATTCTCAGTGAAAAATAAGACACAGGTCATAC
CCTCTAGACACTTACAATTACAGTGGCAAGGAGTCATTCTCCTGTCACTGTAAGTGGCCAAGCACAGACTGGGTCCCCAC
ATGTCAGGGCTGAAAACTCACAGGGAAATCTGTGAGTTGGGAGGTGAGAGCAGAAGAGTCCCGTAGTTCCTTCTCACTCT
GATGCATTTATCATTCTAAACCCAGACTTTCACATACACATTCATCGTTTTCTTTCATGATAATAGTTGCTTTTATCCTC
TTATCTTTGCTAATTCTTACAAACTAATAAAGACTAAGAAACAAAATAAATTAAATCCTACAGGTGTTCCAAACTCAGCA
ATAATTTCTAGTTGGCCTCTAAAACAAAAATCAAAATATAAATGTAAGAAAAGTTTAGAATGCTTAGTACCTGTGTGATG
AAATAATCTGTACACTAAACCCCCAAGTCATGAGTTTACCTATACAACAAACCTGCACATGTACTCCTGAACATAAAATA
AATGTTGAAATATTTTTAAAAAGGAAACAAAAGTTTGGAACAAATGCCAAAATAACTGTACTGTACTTTTGAATTTATAT
GCCCCAAATGAAAAATATTATCAACAAAGCTATACATTCTACAGTTTCATGTTCATAAACTAAGACAGAAACTTTAAAAC
TGTCAAGAGCCCTAAAATTTGAAGGATATTTTCTTCTTCCTCTCAATTTTGTATTTTTTTCTACCTTTTCTATAATAAGA
AAAAGAAAATGTCCATTCCCCCACCCCCATGACTCTAAAAACAATTTTACATCTGTGTCATAGAAAAATTAAGATCTTAA
TGGGAGAGAAAACCTCTCTACTAGTTCCGCCAGTAGCCGTATGACCTTAGCAAGTTATTAATATGTAACTTCCCTGCATT
TCCTTACCTGTAAAATGTATGATATGTATTTGCTTCATAGGGTTATTGTGACAATTCAGCGAGTGAAATATGTAAAGTAT
TTAGAAGGATGCCTGGCACAAGTAAGTGCTCAACAAATGTTAGCTGTCATTGTTACTATTACTATTGTGTAGGGTCAGGA
TGCCCAGACTTTCAAAGACCAGGAAGCAGCTTGACTTATCAGTGATAAACTTTTCATTTTGTTCTTTGCTCCTTTCTTTT
TATAACTGCTCATCTGCTCTGTATTATTTCCTTTATGGTGTTGCTCCTTCTTCTTCCCCATATGTCCTTCCTTTGACCTC
TTACCTTCTTCCTTTTTATATTCATAAGTCTTTATTCATTCTCTAGCTTTGACCACTTGCATATTCAAACTGACATTTTG
TCGTGTTTTTCTCTACTGTCTTTATGCAGCGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACGCATAGACCAACAG
GGGAGTTTATGTTTGAATTTGATGAAGATGAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAG
GAGTTTGGCCAAGCCTTTTCCTTTGAGGCTCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTT
GATCCAGCGTTCCAACCACACTCAGGCCACCAACGGTACGCCCTATCTTTGCCTCTTCCTCTGTAGCCCAACTGGAAGGG
ATGAGAGGGCCTCTCTGCCACCCTCAGACTAGGAAGCCTAAGTGCCCCCTGCTGTGTGATCCTCTTCCCCTAGTGGCCAT
GGGCTGATCCCACTACAGCAAGGGCTTGCATCCTCTCTTCTCAGGAGAGAGAAAGGTGAGCAGAGTGAGGCTGGTCAGTG
GTGTGATACCCCTCTCTGTGATTCAGAGCTGCCATAAAATCTAAGGCTGAGGTAGAGGACCACCCTCCCCTAAGAGGTGG
AGCCTTTGTGATTCATCCCAGAAGAGGGGCCTAACCTGGTGCTGTCTCCTTCCAGATCCCCCTGAGGTGACCGTGTTTCC
CAAGGAGCCTGTGGAGCTGGGCCAGCCCAACACCCTCATCTGCCACATTGACAAGTTCTTCCCACCAGTGCTCAACGTCA
CGTGGCTGTGCAACGGGGAGCTGGTCACTGAGGGTGTCGCTGAGAGCCTCTTCCTGCCCAGAACAGATTACAGCTTCCAC
AAGTTCCATTACCTGACCTTTGTGCCCTCAGCAGAGGACTTCTATGACTGCAGGGTGGAGCACTGGGGCTTGGACCAGCC
GCTCCTCAAGCACTGGGGTATGCAACTGCTTTTCTCTCCATAATCTCCTGGCATCCTCTATTCCAAAGACCTGGTGTCCT
CTGCACCAGCTTTCCGCACTGGCTGGGTCTCAGTCCTCTCCTCGTCCTAACATCCAATTAACTGGTCCATAACCTTCAAT
TCCCACAACCATCCCAGGCCATCACCACCCTCACTGCACCTCCTGACCCTATCTCTTCATTCTTCCCCCAGAGGCCCAAG
AGCCAATCCAGATGCCTGAGACAACGGAGACTGTGCTCTGTGCCCTGGGCCTGGTGCTGGGCCTAGTCGGCATCATCGTG
GGCACCGTCCTCATCATAAAGTCTCTGCGTTCTGGCCATGACCCCCGGGCCCAGGGGACCCTGTGAAATACTGTAAAGGT
GGGAATGTAAAGAGGAGGCCCTAGGATTTGTAGAATGTAAGGAAGGGAGGAAAAATTCAATCTGATAAGTGTTCATTGAT
CTTCTAATGGGTTAAAAGCATTCAGCCACATAACAACAACAACACCGATAACTAACTGAGTAGTTAATATGGTCAGGCGC
TATTCTGAGGATTTACATTTATTAACTCACTTTATTCTCACACATAGTCTTTGAGGTAGGTACTATTATTTTCACTATTT
CACATGAGAGATACTTACATCTTTTTACATACACAGAGACTTTAAGCACTTTGATCAAGTTCCCACAGCTATGAAGTAGT
AGGGCTAGCTTCCAATCCAGAAAGTCTGGATCCAAGACTGTTTATCCACTGTCCTATTCACCCTATTTTGTGAAGGAAAA
GACCAAGTTCAAATTCTCCAGAGTCCATTGCCAAATAATGGAGTCAGATCTATATTTCTATACATAATTACAACACAGTG
TGGTGGGTGCCTGTAACTACTTACTGTCTCTACTTGGACTCATTCCATGGCAATGTTCACACAAAAAATGCCTCTCCAGA
GATCTTACAGGTTTCTATTTATCATAACACTCACCATGCTTTATATTTTTATATGTTTTGGGAATTCTCTTAGCATTAGA
CAGTGAACTTCCATGCAGATGACCACATCTAATTCATTATTATTATTGTTATTCATGCTGGACCTCAGGTACAAAAGGTT
AAGAACTTCTCAGTTCATTATATGATCATCATTGGTGCCTCCGAGCTCTCTCTCTCTCCCTTGATTTATTTGGTCCCTTT
TATCTCCAGTCCTTACTCCCATATCTAACCTCTTACCCCTACCTCATAGGTAAACATTTTAATGAATTTGATGTTTCCTT
TTATTTGCATAGATCCTCTGTAATATGTAGTAGTGTCCAGTGTACATGTATTTTTAATTAACCAAAATGGCATTAAATTA
TAGATCTAATTTTGTACATCCAGTTTGTTTCTTCCAAATCTTCCATAGTATTTTACTTTATATGTCCATGCATTAGTCCA
TTTTGCATTGCTATAAAGGAATATCTGAAGTTACCTAATTTACGAAGAAAAGAGCTTTAAATGGCTCACAGATCTGCAGG
CTGTACGCGAAACATGGCACTAGCATCTGCTTCTGTTGGGGGATTCTGGAAGCTTTTACTCATGGTGGAAGGCAAGTGGA
GCCAGTGCATCACATGGTCATAGAGGGAGAAAGAGACATAGAAAGAGGTGCCAGCCTCTTTTTAACAACCAGGTTTCATG
TGCACTAATAGAGTGAGAACTCACTCATTACCCGGAGAGGGGACAAAGCCATTCATGAGGGTCTCCTCCATGATTCAAAT
ACCTCCCACCAGGCCCCACCTGCAACACTGGGGATCAATTTTCAACATGAGACTTGGAAGTGACAAATATCCAAATCATA
TTAATCCACATATCTACATTGCTCCTGGGATACCTGGATCATTCCTGGTTCTCTACTATTGCAAGCAATGCTTGTATCTC
ACATGGAACTGCATATACATGTGGGCCTGACCTGCATCCCTGGAATGTATGTATCCTAGAAAGGGGTTGCAGGGTTGTTG
GAGATGCAGCTCCTTAATTTGACTAAACACTGCTCATCTTCTCATCAGAATGGCTGTACTCATCTGAACTTCCTTTGTCA
GTACTCTAATTGTCCTGCAACTCCTAAATGGACTTCAACACTGGACATTATCCAGTTTTCTAACTTTTGCCAATTTCATG
TGCATAAAGAAATATGCTGTTTTATTTTGCATTTCTTTAATTACTAATAATTGGGGCTATAATTAGGACTGATTAGCCAC
TTGGGGGTTCCTTTTCTATAAATTGCCTGTTCACATTCATTGTCCATTTTTGTACTATGTGCTTCCATCATTTTCTTATT
GATTTGCAGGTGATCCTTATATAGTCCTGCTAGTAGTCCCTTGTCAGTTTTAGGCATTGCAAATGTTTTCCTCTAATCTG
ACTTCTGGCAACTGTCTCCTTGGTTTCCTTTATTGAAGAGAAATCCTTAATATTTTGTAATGAAGTCCATCAACTGTATT
TTTGTTTGTGTGTCTTTTTTAAAAGAAGTCTTCCCTATACTGAGATATCAAAGATACTCTTAAAACATCTCCTACAGTTT
TAAATTTCACATTTACTACTTTAATTCATCTGGGATTCATCTTTGTGTTTGATGGGGATCATGTTTTATTTTTCTTTATA
TAATGGGCCAGTGTGTTCCCACAACTACTAAATAGTTCACCTTTTCCCCATAGGTTAGTAGTGTCTCCTTTGCTATACTG
AAAGCTCCCATTATAGGTGGGCCTGTGTCTGAGTTCCATCTTGTTCCACTGTTCTGTTTGTCTCTTCTTGTGCCAGTGTC
CTAGTATTTTGATTACTATGACATTGTAGTGTGTGTTAGTATCCAGTAGGACAAATTCTTGTTTATTTTTCTTAGTTCAC
ACACATTTATAATTATATCTATAATGATTTGTAACAGAGTGAAGTGAATGTAGAATGTCAGATGTTAAGAGGAAGAATGG
AAAAGAGGGCTGGGACTAGGGTGATGTAGGGGATGCACTTGGCTTAGGTGCAAAATTTGGGGGATACCAAAAGAACTCAG
TAATAAATCATATTTTAATGAAATATCTTGAAAAGGCAAAATTAATGCAAAGATACATGATTAACAAAACATCCAAAGAG
GAGTATTTAACAAAAATGGAGAAGCAGAGAAGCAGAAGAATTAGGAGAATATGCTGTCACATGAGCCAAGGAATTAAAGA
ATTCAGGAAGGAGGAAGTACTGCTGTCAGATGTTCAACAGAGGTCATTTTAGAAAATTTACCTTGGTTTTTGAAATCCTT
TCAAAGAGCAGTATACACAATGTGAGCAAGTATCCTTCGTTCATTGCCGTCATTGATATGGTTTGGATATTTGTCCCTTC
CAATTCTCATTCCAGGGTTAAGCTTCTTCTCTGCCCTCAGTAATGTGGCCCTTCCCCTTGTCTGTATATTTTGGAGACAT
GAAGCATGTGGGATGGCCTCACAGTCAGCTGGGGTTTGAGGGTGAAATTCAATGACTTTCGTGAACTCCTTGGCTCCTAT
GTGCTCTTCACCTGGAGGACCAGGGCATGTGCAGGGATGACCACCTTCTCCCTGGGACCTGAACAGGGCAGAGAAATGGG
AAGCTCGGGTGCAAAGGGAGTGGGGAAGATGGGTCCGGGCTTACAGTACTGAACCCAGGAATGACAATAACTGTGTGTGT
TGCTGCAGGTGACAAAATATCTGAACAGAAGAGGACTTAGGAGAGATCTGAACTCCAGCTGCCCTACAAACTCCATCTCA
GCTTTTCTTCTCACTTCATGTGAAAACTACTCCAGTGGCTGACTGAATTGCTGACCCTTCAAGCTCTGTCCTTATCCATT
ACCTCAAAGCAGTCATTCCTTAGTAAAGTTTCCAACAAATAGAAATTAATGACACTTTGGTAGCACTAATATGGAGATTA
TCCTTTCATTGAGCCTTTTATCCTCTGTTCTCCTTTGAAGAACCCCTCACTGTCACCTTCCCGAGAATACCCTAAGACCA
ATAAATACTTCAGTATTTCAGAGCGGGGAGACTCTGAGTCATTCTTACTGGAAGTCTAGGACCAGGTCACATGTGAATAC
TATTTCTTGAAGGTGTGGTTTCAACCTCTGTTGCCGATGTGGTTACTAAAGGTTCTGATCCCACTTGAACGGAAAGGTCT
GAGGATATTGATTCAGTCCTGGGTTTTTCCCTAACTACAGGATAGGGTGGGGTAGAGAAAGGATATTTGGGGGAAATTTT
ACTTGGATGAAGATTTTCTTGGATGTAGTTTGAAGACTGCAGTGTTTGAAGTCTCTGAGGGAAGAGATTTGGTCTGTCTG
GATCAAGATTTCAGGCAGATTAGGATTCCATTCACAGCCCCTGAGCTTCCTTCCCAAGGCTGTATTGTAATTATAGCAAT
ATTTCATGGAGGATTTTTCTACATGATAAACTAAGAGCCAAGAAATAAAATTTTTAAAATGCCCTAATTCATTGCAATTT
TTACCAGCCATAGTCACTCCATGTGGGAGAACTTAAATCATGATTACCAGAGCTTTCAAAGGTTTGAGAATAGTGATGAT
TATGAAGAAAAATATCTTATTTGAGCAAGGATTTTGTTTCTTTATGAGTGTTCATTAGATATTACGATGAAAAAAGCATG
AAATGGTAAAAATTCAGATAAATATAAAAACATGTTCTCTAGTTTTTTTTAAGTTAAAAAAGGAATTGTTTAAAGTA

IMGT/HLA

Sponsors

Animated Sponsors Logo