Allele Report for DPA1*01:03:01:01

DPA1*01:03:01:01 View HGVS Report
Pre-2010 Nomenclature: DPA1*010301 Local Names: DPA1*01031, 8+RI, LB14/LB24, DPA1, pSBa-318, DPw4a1
IMGT/HLA Acc No: HLA00499 OMIM Entry: *142880
Assigned: 1989-08-01 Sequence Last Modified: 1999-08-06
Source Entries: AL805913 , CR847849 , K01506 , M23903 , M23904 , X00457 , X03100 , X82389 , X82390 , X82392  
Cells Sequence Derived From: BOLETH , LB , LG2 , PRIESS , QBL , T5-1  
Known Ethnic Origin Of Source: Caucasoid
Publications
Okada K et al. EMBO J 4:739-48 1985. (View abstract)
Trowsdale J et al. Immunol Rev 85:5-43 1985. (View abstract)
Auffray C et al. Nature 308:327-33 1984. (View abstract)
Lawrance SK et al. Nucleic Acids Res 13:7515-28 1985. (View abstract)
Rozemuller EH et al. Tissue Antigens 45:57-62 1995. (View abstract)
Gustafsson K et al. J Biol Chem 262:8778-86 1987. (View abstract)
Bugawan TL et al. J Immunol 141:4024-30 1988. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 7
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (260 aa)
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFG
QAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVT
EGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL
Nucleotide Sequence Data (783 bps)
ATGCGCCCTGAAGACAGAATGTTCCATATCAGAGCTGTGATCTTGAGAGCCCTCTCCTTGGCTTTCCTGCTGAGTCTCCG
AGGAGCTGGGGCCATCAAGGCGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACGCATAGACCAACAGGGGAGTTTA
TGTTTGAATTTGATGAAGATGAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGC
CAAGCCTTTTCCTTTGAGGCTCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCG
TTCCAACCACACTCAGGCCACCAACGATCCCCCTGAGGTGACCGTGTTTCCCAAGGAGCCTGTGGAGCTGGGCCAGCCCA
ACACCCTCATCTGCCACATTGACAAGTTCTTCCCACCAGTGCTCAACGTCACGTGGCTGTGCAACGGGGAGCTGGTCACT
GAGGGTGTCGCTGAGAGCCTCTTCCTGCCCAGAACAGATTACAGCTTCCACAAGTTCCATTACCTGACCTTTGTGCCCTC
AGCAGAGGACTTCTATGACTGCAGGGTGGAGCACTGGGGCTTGGACCAGCCGCTCCTCAAGCACTGGGAGGCCCAAGAGC
CAATCCAGATGCCTGAGACAACGGAGACTGTGCTCTGTGCCCTGGGCCTGGTGCTGGGCCTAGTCGGCATCATCGTGGGC
ACCGTCCTCATCATAAAGTCTCTGCGTTCTGGCCATGACCCCCGGGCCCAGGGGACCCTGTGA
Genomic Sequence Data (4921 bps)
ATGCGCCCTGAAGACAGAATGTTCCATATCAGAGCTGTGATCTTGAGAGCCCTCTCCTTGGCTTTCCTGCTGAGTCTCCG
AGGAGCTGGGGCCATCAAGGGTGAGTGCTCAGGAGGACGCAGGAGCGTCGGGGTGAGTGATGGGGTGGTTCACATCAATT
GCTGCTTCAGGGATCACAGATTTTAGGGGCTCATTGATCTATCTGGTCCTCATAGTCTATGTTCCCTCTGGCCCTCATAA
TAATAACAGCAATAACAGCCAGAATTTATGAGACTCCTGCATAGTTTCTTTCCCCATTTACATCTCACAGGAATCTTCAA
TGAAGATAATATTCCATTCATTTAGAAATTATTCCTTTTATTTAGAAATTATTTTGAAAAAACTGAAGCTCAAAAAGATG
AATAAGTTTTCCAAGGTTACACAGCAGATCAACGAGCCAAGTTTGAAGTCCAGACCCAGCTCTGAGGGTCATACACTGCC
TTCCCCAGATTCCTGCACACAGTGACCTACTATCAGGGCCCTCCTATCTCTCTGGGATCCCCAGCCTCTATCTTTTGTGG
CTGCTTTACAGGAACTCCGAGCTATGGACTCTGCATTAGGAGACGAAGTGCAAAGAGTGTTTCTGTATCCTCCCTCTCTT
CTAGGACCCTAGGGCTCTTCCTGGGTCTTTGTGGGTGGTCACAAGCTTTCCTCTCTCAAGACAGCAGGGTTGCATGGTCT
TGATAGCCTTGTGATTCGGGTTCTGAGAGATTCAGGACTGCAAGGGAGGCCTAGACTTTTGATAGCTGCAAGGACTCAGC
CAGAGATGGACCGTAGTGAATGCTCCTTTTTCCTGTAGCTGAAATCAGGGAGAATGACATCAAGCCTGTGCATGATGCTG
TCATTCCAAAATCTAGTGATGGGGAAGGTTAGAATCCATAACGTACAAGATGCACACTGGCTTCAGACAGTTTTATTTAA
GATGTGTAGAATAAAGAGGAGGTCAGGCTGGGTAGAACCAGAAGTATCTATTGCCCTGTTCGCGGTCACCTGAGTTATTT
CTAATGTTATGTTATAATAAACACCACAATAGGCTTCTCTTCATAGATGCAAATACTTTTTAGTATTCTTGGTAGAAATT
CCTAATGAGCTCAGCTGTCTCTTCAGGGCTTCCCTGCCCAGTCTCTTAACATTTAAACATGTCATTTACCTTAAAAACAT
AAGTGCAAACCAACTGATAAAAAACAACCTTGCCTTCAGTCTGCATCCTGTCCCAGAGACACTTTCTTTGTGTCCTCACA
CGTGGAGCTAAGCTTCTGACTTGTCTCTGGTACATCCCTGAGGATCCTCTCATCTTGGCCATCAGGAACCTCTACAGAAG
GTCAAATTCAGTGGGTTCTTCTCAGTGCCTCTGACTTGAGTTACTAATAACATTTGCACTATAATCCACTTCTTTCTGAT
GAACTACCCTGTCCTTATTTTTCTCCTGTTTACCTGGATCCTCCTTATCATCTTTTAAACCACCTCTTAACTATCATGTT
CTCTCATTATACCCTGAGATCTCGGCAATTCTGATTTTTGGCACTCTTCCTGGAAAATCTTATTTAACCTGCACCTGCCA
CTAATGACTCTCAGTTCTATGGCCTAAATTCCTCTCCTGAGACCACCCATAATCCACAAATATCTATGTATTATTTCTCC
TTAGATGACTTTCAGGTCTTCTAAGTGCAATAGCCCCACAGTGAACTCAGTATCTTCTCCCGGTCAGGCTGTCTTCCCTG
AGAGAAGTGGCTTTTGCCCTGTTTTCTGAATGCCTACATTGAAGCCATCTGTTCCCCAGGAAGCCTTCCCTGATGTGCTG
TTTGGTCGCATCTTGTGTATACCTACGTATCTGCACTTATCCTTCTGAACCTGCTGTTGTCCTGTCACTTGTGTTTCCTT
CTGTGACTTATACGCGTCTGCAGAACAGGACGTATGTATTATTTTTATTTGGGTATTTAGCATCTAACAGTGTTTGACAT
ATAGTAGTCTTTTAATACATATTTTTGTCTGAATGGAAATGATATTTTGAAGAAAAATAATCTGTTCCATAGCTGGCTGA
TCTTTGGACTGCAGAACTTGTGAAAGTGTTTTTTAAAAAGCATTTTAAAAAGTACAAGGGACATTCATGTATTAAGAAGA
TGAGTTTCCAATAACTGCTAGAGGACTTTGTGTCTTTTTATTTTACCCTCTTTTTCCTGATGAGTCCTTTGAGTCCTTTA
AACTGAGGAGCAAGCTAAGTTTCCTAGTGAAATACCTATAGGATTTGTTTTGTTTAGTTTCAAATACCACTCTTTGCTTG
GCCACTTACTGTGTCAGGGAGTCATTCTCAGTGAAAAATAAGACACAGGTCATACCCTCTAGACACTTACAATTACAGTG
GCAAGGAGTCATTCTCCTGTCACTGTAAGTGGCCAAGCACAGACTGGGTCCCCACATGTCAGGGCTGAAAACTCACAGGG
AAATCTGTGAGTTGGGAGGTGAGAGCAGAAGAGTCCCGTAGTTCCTTCTCACTCTGATGCATTTATCATTCTAAACCCAG
ACTTTCACATACACATTCATCGTTTTCTTTCATGATAATAGTTGCTTTTATCCTCTTATCTTTGCTAATTCTTACAAACT
AATAAAGACTAAGAAACAAAATAAATTAAATCCTACAGGTGTTCCAAACTCAGCAATAATTTCTAGTTGGCCTCTAAAAC
AAAAATCAAAATATAAATGTAAGAAAAGTTTAGAATGCTTAGTACCTGTGTGATGAAATAATCTGTACACTAAACCCCCA
AGTCATGAGTTTACCTATACAACAAACCTGCACATGTACTCCTGAACATAAAATAAATGTTGAAATATTTTTAAAAAGGA
AACAAAAGTTTGGAACAAATGCCAAAATAACTGTACTGTACTTTTGAATTTATATGCCCCAAATGAAAAATATTATCAAC
AAAGCTATACATTCTACAGTTTCATGTTCATAAACTAAGACAGAAACTTTAAAACTGTCAAGAGCCCTAAAATTTGAAGG
ATATTTTCTTCTTCCTCTCAATTTTGTATTTTTTTCTACCTTTTCTATAATAAGAAAAAGAAAATGTCCATTCCCCCACC
CCCATGACTCTAAAAACAATTTTACATCTGTGTCATAGAAAAATTAAGATCTTAATGGGAGAGAAAACCTCTCTACTAGT
TCCGCCAGTAGCCGTATGACCTTAGCAAGTTATTAATATGTAACTTCCCTGCATTTCCTTACCTGTAAAATGTATGATAT
GTATTTGCTTCATAGGGTTATTGTGACAATTCAGCGACTGAAATATGTAAAGTATTTAGAAGGATGCCTGGCACAAGTAA
GTGCTCAACAAATGTTAGCTGTCATTGTTACTATTACTATTGTGTAGGGTCAGGATGCCCAGACTTTCAAAGACCAGGAA
GCAGCTTGACTTATCAGTGATAAACTTTTCATTTTGTTCTTTGCTCCTTTCTTTTTATAACTGCTCATCTGCTCTGTATT
ATTTCCTTTATGGTGTTGCTCCTTCTTCTTCCCCATATGTCCTTCCTTTGACCTCTTACCTTCTTCCTTTTTATATTCAT
AAGTCTTTATTCATTCTCTAGCTTTGACCACTTGCATATTCAAACTGACATTTTGTCGTGTTTTTCTCTACTGTCTTTAT
GCAGCGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACGCATAGACCAACAGGGGAGTTTATGTTTGAATTTGATGA
AGATGAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGCCAAGCCTTTTCCTTTG
AGGCTCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCGTTCCAACCACACTCAG
GCCACCAACGGTACGCCCTATCTTTGCCTCTTCCTCTGTAGCCCAACTGGAAGGGATGAGAGGGCCTCTCTGCCACCCTC
AGACTAGGAAGCCTAAGTGCCCCCTGCTGTGTGATCCTCTTCCCCTAGTGGCCATGGGCTGATCCCACTACAGCAAGGGC
TTGCATCCTCTCTTCTCAGGAGAGAGAAAGGTGAGCAGAGTGAGGCTGGTCAGTGGTGTGATACCCCTGTCTGTGATTCA
GAGCTGCCATAAAATCTAAGGCTGAGGTAGAGGACCACCCTCCCCTAAGAGGTGGAGCCTTTGTGATTCATCCCAGAAGA
GGGGCCTAACCTGGTGCTGTCTCCTTCCAGATCCCCCTGAGGTGACCGTGTTTCCCAAGGAGCCTGTGGAGCTGGGCCAG
CCCAACACCCTCATCTGCCACATTGACAAGTTCTTCCCACCAGTGCTCAACGTCACGTGGCTGTGCAACGGGGAGCTGGT
CACTGAGGGTGTCGCTGAGAGCCTCTTCCTGCCCAGAACAGATTACAGCTTCCACAAGTTCCATTACCTGACCTTTGTGC
CCTCAGCAGAGGACTTCTATGACTGCAGGGTGGAGCACTGGGGCTTGGACCAGCCGCTCCTCAAGCACTGGGGTATGCAA
CTGCTTTTCTCTCCATAATCTCCTGGCATCCTCTATTCCAAAGACCTGGTGTCCTCTGCACCAGCTTTCCGCACTGGCTG
GGTCTCAGTCCTCTCCTCGTCCTAACATCCAATTAACTGGTCCATAACCTTCAATTCCCACAACCATCCCAGGCCATCAC
CACCCTCACTGCACCTCCTGACCCTATCTCTTCATTCTTCCCCCAGAGGCCCAAGAGCCAATCCAGATGCCTGAGACAAC
GGAGACTGTGCTCTGTGCCCTGGGCCTGGTGCTGGGCCTAGTCGGCATCATCGTGGGCACCGTCCTCATCATAAAGTCTC
TGCGTTCTGGCCATGACCCCCGGGCCCAGGGGACCCTGTGA

IMGT/HLA

Sponsors

Animated Sponsors Logo