Allele Report for DPA1*01:10

DPA1*01:10 View HGVS Report
Pre-2010 Nomenclature: DPA1*0110 Local Names: DPA1*010301v1
IMGT/HLA Acc No: HLA03223 OMIM Entry: *142880
Assigned: 2008-01-30 Sequence Last Modified: 2008-04-08
Source Entries: DQ274061  
Cells Sequence Derived From: BM3950  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lee KW. Tissue Antigens 71:575-7 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (81 aa)
DHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVCHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAT
N
Nucleotide Sequence Data (246 bps)
CGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACGCATAGACCAACAGGGGAGTTTATGTTTGAATTTGATGAAGAT
GAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGTCATCTGGAGGAGTTTGGCCAAGCCTTTTCCTTTGAGGC
TCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCGTTCCAACCACACTCAGGCCA
CCAACG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo