Allele Report for DPA1*01:03:03

DPA1*01:03:03 View HGVS Report
Pre-2010 Nomenclature: DPA1*010303 Local Names: KOR10099
IMGT/HLA Acc No: HLA01937 OMIM Entry: *142880
Assigned: 2004-06-25 Sequence Last Modified: 2005-01-12
Source Entries: AY618552  
Cells Sequence Derived From: KOR10099  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Not defined
Publications
Luo M et al. Tissue Antigens 65:120-2 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (81 aa)
DHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAT
N
Nucleotide Sequence Data (246 bps)
CGGACCATGTGTCAACTTATGCCGCGTTTGTACAGACCCATAGACCAACAGGGGAGTTTATGTTTGAATTTGATGAAGAT
GAGATGTTCTATGTGGATCTGGACAAGAAGGAGACCGTCTGGCATCTGGAGGAGTTTGGCCAAGCCTTTTCCTTTGAGGC
TCAGGGCGGGCTGGCTAACATTGCTATATTGAACAACAACTTGAATACCTTGATCCAGCGTTCCAACCACACTCAGGCCA
CCAACG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo