Allele Report for DOB*01:01:03:02

DOB*01:01:03:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: DOB*01:01:03:XX
IMGT/HLA Acc No: HLA06467 OMIM Entry: *600629
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: AL671681  
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLG
QPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLN
GQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Nucleotide Sequence Data (823 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGACTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAG
Genomic Sequence Data (4786 bps)
CATAATAAACAGTCTGCCTAGTTCTTCTAGGGCCCCATAATATGTCAAACATATATTTTTACTTCTTCTCCCAGCCCATT
TTTAGTATACCTAAATTACTGTCAGTGATTCTGCAGGCAAACAATGGTTGAGTTGTATGACACAACTTTGTGAAAGTATC
CTACCCAGTACCTGATGATGCAAAACTCTTCTATCTTGATTGGTTGTCAATCTGAGGAGTTTCCAATCCTGGGGAAGCCA
GAAAAACAGCGATTTATACTCTTAATGGGTACTTTCTGACTGAATTTTATGAGCTCATTCTGAAGAGGCTGACGATTTTA
CTATCTCATTTTTTTCCTTTCTCCAGAATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCG
ACTGGATTCCTCCATGACTCAAGGCACAGACTCTCCAGGTAAGAACAGAGCAATTGTTTTTTTCCAGTGTGTATGCAAGA
ATTGGCATGGGGGAGTGATGCCTTTCTTTGTAAGTCCAGGCCACAGACCAGACTGGAAGTGGCTTTTGGTTTCAAAGAAC
AGTGTTCTTCCCTTTGGCAGAAAGGTACGCCTTGCCTCTTTACATGGGATGGACTTCATATACCAGAGCCACCTATTCAA
GGGGTAGGGAGGCAGGAAGAGGGAAACATTGTGTCTTGTTTAGGATCCTTATTGTGTGTATCAACCTCAGTCAGTGCCTG
GGCGTGTTGAAGGCCTTGGCTTGGGTTCGAGCCTGCTGGGAGAAACAACCTGCAGTAGGCTGGGTCACAGAGGCAATCTG
TGATTTTTTGGTCAGGACACGGAAACAAATCTCAGTTGGGGTATATGTGGACAAATGAAACTGGAAACAAAGGTTGCTCC
TTCTGTCATTTATTAAGCCACTATTATATTGTCAGAATTGTACTAAACAGTTTTGAGAAGTAAGAGAAGTTGAATAGAAT
ACATTGTCCTTGTCCTCCGGCTACCAGGTACAAGTTACTTGTCACTGTTATTTTTCTAGCACAGGTGACAGAATATGCAG
CCATGAAGCAATGTGAGATGAAAGCACATATTAATGAGCAGAAACAGGATGTAATGTGCTAAGAACAGAATCCCCTTTGC
ATGTTAGTTTCATTAAATACAAAAGAGGAACAAACCTGGCCAGGAGAGATCATTATTCTCAGAGAATAGAAACCGCCCTG
AGTTTATAATGTCCATTAAACAATACAACTGAAAAAAAAATCAGCACAGATGTTAAATGATGATGAAAAATTCAGATTTC
CCCCCTGGTTTAGACTACTAGAGGAAATAGAGAAGAGTATACATGCTGAGAAATTACAGGCTGGAACTTCATCTGAAATT
AGCTACTGAGTGAGGGATAAGTGGGGTTCACCCAGGAAGGTCATTCTTATGGCTCAGTTCAGAGTTGGAGGAGGCTTCTG
AACTTAGAAAGGAAAGTAAATTACAACCCAACATTAATAGCAATTATCTTTCAAGTCTTGACTTAGATGCAATGTCTTCA
GGACGTCCTTCCTGACTTACCTACATTATTAACTCCATTTGAATTTCCTTTTTATTGTAGTTGTTGTTCTTAAGTGCATA
GGATTGGTTTAATTTTACCCAATGAGTTCACAGCACATTGTAATTATTGGCAGTAGTGCAAGACTCTCTCGTCTCTTCTC
TTGCCTCCGTTCTCATTCTCTCCCCTCCCTAGAGAATCCATTCTAAACGTGTCTGGTAAGTCTCTAAGTATGAGAGTGGC
TTTTAGAAATATGTAGCATTATTGCTCTTTATGTGTTTTTAAAATTTAATAAATGTCATTCTCTGTTGAATCCCATTCTG
TTTCTTTTCTCACTTGACACTGTGCTTTTTGAGCATACTGAGGTCAAAGGCCTCCTCTTAGATCCATGTGGTCTGACGTA
ATTTACCAGGCATGGGTTTTCCCAGAGGAGGGGGCTGGTTCATGGTTTTGGTTTTGGTTTTCCAGAAGACTTTGTGATTC
AGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGGTCAGATTCATCTTTAACTTGGAGGAG
TATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGGCAGCCAGATGCTGAGCAGTGGAACAG
CCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACACAACTACAGGCTGGGCGCACCCTTCA
CTGTGGGGAGAAAAGGTGAGCTGGAAGCTGAGGTCTGGCGGGGCTCAGGAATGTCCCCCATGTGAACCTGGCCATGGCTC
TTCTTTCTTACAAGCAATTTTCTGCTTTAGGATAAATGGTTGTCTGTGTAGATGTTCTGGCCCCAGCTGTGATATATTAT
CCTCACAAGTCAGCCACTGTGATCTTGGTCTCAGACCCCCAAGGTTCTCAGGGACTTCGAGGGCTATTGTGCCCTCAAAG
AGAAGCAGTAATTGTGGGAGTACCTCAGAAAGTCTAAATCCTCCTGACAGGCATTGACATACCCTGTTACTGATCTTGGG
GGCTGAGACTTGCCTATACTTTGTGTTCACTTGGGTGATCTGGGAAAGAGATTAGACATAGTGATAGTCCCTAAAGAATC
TCCTGTCCCAGCTTGGTGGTTTTCTTTCACGGTGTCTCATTTTTCCTCCCTTCCTAGTGCAACCAGAGGTGACAGTGTAC
CCAGAGAGGACCCCACTCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGAT
CAAGTGGTTCCTGAATGGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTC
AGACTGTGGTGATGCTAGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGC
CCTGTTTCTGTGGAGTGGAGTGAGAATTAGTTTCTAGTACTCTCTGGGCCTGACTCAGGACTATACTGACTCAATACAGA
GCCTGTGTCACTTCTGCGTTTATCTTGGTCACAACATGAATTATTCTTTCCCTTGATCTGGGACAGTCACAGAAACCAGA
GTCCTTGGGTTAGGGTGGGAGAAAACATGGCAGATATCTATCCTCATATCTTCCAAGAAATGAGGAGATCTAATCACCTC
ATTATGTGCTTCCAACCCTATGAACTGGTGTCCTCTAATTCTTTGGTCTTAGTATTTAGGAGGCATTCTTATGGGCTGTG
AGAATCTGTAACCGATGGGGGGTAACTCCATGGGTGCCAACTTTGGTTTCGAAGAACCTTTTCTAAATTTATTTATTTTT
CTCTAGCTAGCATTGGATTTGGTGTCTAGTACAGATTCTGGGATTCCAAGAAAGTGCTTTAAATATTGGGATATTTTTAC
TAATTTAAAGACCTGTTTCCCATAGGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCT
ACTTGGGCTAATCTTCCTTCTGGTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGTAATGAGCCTGTGAGGAGTGCCC
TGCCACCTGTCCCAGACCTTCCCCACTCCCACCTTCCCTAACGTCAATGATCTGAGGCAAGGAAAGCTGATTGTGCCTCT
CAGGGATCACCGGGATAATTTTTTTCTGAAGCTAGAAATGGGATAAGCAGAGAGAGTGCTGACCTTGCCAGCCATTTGTT
CTTCCCTCGGGATAATCATATTGGGTCCTAATTGGGGCAATCCATTCTTTTCTCGATTTCTTTCCAGGATATGTGAGGAC
GCAGATGTCTGGTAATGAGGTAATGTCTCTTTTTCCTTGTCTTTGAGTGGCAGATCATTCTCCCGGTTCTTTGGCCAGAG
GGAGATGACATGGGGGTAGGGAGGAGTAAGGTTGCTGCTGTCTGGATGGGACTGTCCCCTGAGTCTCTGGAACGGCTGTG
GGGGGTGGTGAGGCTGCCTCCTGAGACCTTCATCACTGTGCCTCCAGGTCTCAAGAGCTGTTCTGCTCCCTCAGTCATGC
TAAGGTCCTCACTGAAGCTTCTCTCTCTGGAGCCTGAAGTAGTGATGAGTAGTCTGGGCCCTGGGTGAGGTAAAGGACAT
TCATGAGGTCAATGTTCTGGGAATAACTCTCTTCCCTGATCCTTGGAGGAGCCCGAACTGATTCTGGAGCTCTGTGTTCT
GAGATCATGCATCTCCCACCCATCTGCCCTTCTCCCTTCTACGTGTACATCATTAATCCCCATTGCCAAGGGCATTGTCC
AGAAACTCCCCTGAGACCTTACTCCTTCCAGTCCCAAATCATTTACTTTTCTGTGGTCCAGCCCTACTCCTATAAGTCAT
GATCTCCAAAGCTTTCTGTCTTCCAACTGCAGTCTCCACAGTCTTCAGAAGACAAATGCTCAGGTAGTCACTGTTTCCTT
TTCACTGTTTTTAAAAACCTTTTATTGTCAAATAAAATGGAGATACAAAAAATGTACATTTTAGTGAATTATTTAAGAAA
AACCCCTGTAATCAAGTCAAGGAACAGGACTTTGCCAGCTCCAGCAGAAGTCTCTGTACGTCAGGCCAATCAAAGCCTCT
CCTTCCCCTCGAAAGTGACCATATCCTGATTTTATTGTAACCTCTTTCATGTCTTTGTAGTCTAGTCCCCCAGGTATGTG
TTCCTGGACGCCACAGCTTAGTTGTCTTTTACGTCTCTTATACTTCACTGGTTTCTCCCCCATCAG

IMGT/HLA

Sponsors

Animated Sponsors Logo