Allele Report for DOB*01:01:03:01

DOB*01:01:03:01 View HGVS Report
Pre-2010 Nomenclature: DOB*010103 Local Names: HLA-DOB
IMGT/HLA Acc No: HLA02013 OMIM Entry: *600629
Assigned: 2004-10-31 Sequence Last Modified: 2011-04-08
Source Entries: AY645723  
Cells Sequence Derived From: GRB1070098  
Known Ethnic Origin Of Source: Oriental
Publications
Gu H et al. Tissue Antigens 65:287-8 2005. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLG
QPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLN
GQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Nucleotide Sequence Data (823 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGACTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAG
Genomic Sequence Data (1265 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGACTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAGGTCCTCACTGAAGCTTCTCTCTCTGGAGCCTGAAGTAGTGATGAGTAGTCTGGGCCC
TGGGTGAGGTAAAGGACATTCATGAGGTCAATGTTCTGGGAATAACTCTCTTCCCTGATCCTTGGAGGAGCCCGAACTGA
TTCTGGAGCTCTGTGTTCTGAGATCATGCATCTCCCACCCATCTGCCCTTCTCCCTTCTACGTGTACATCATTAATCCCC
ATTGCCAAGGGCATTGTCCAGAAACTCCCCTGAGACCTTACTCCTTCCAGCCCCAAATCATTTACTTTTCTGTGGTCCAG
CCCTACTCCTATAAGTCATGATCTCCAAAGCTTTCTGTCTTCCAACTGCAGTCTCCACAGTCTTCAGAAGACAAATGCTC
AGGTAGTCACTGTTTCCTTTTCACTGTTTTTAAAAACCTTTTATTGTCAAATAAAATGGAGATAC

IMGT/HLA

Sponsors

Animated Sponsors Logo