Allele Report for DOB*01:01:01:02

DOB*01:01:01:02 View HGVS Report
Pre-2010 Nomenclature: DOB*01010102 Local Names: DOB*0101102, DOB1.2
IMGT/HLA Acc No: HLA01227 OMIM Entry: *600629
Assigned: 2000-05-10 Sequence Last Modified: 2011-04-08
Source Entries: AB035250  
Cells Sequence Derived From: LCL721 , WT100 , WT100BIS  
Known Ethnic Origin Of Source: Caucasoid
Publications
Naruse TK et al. Tissue Antigens 59:512-9 2002. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLG
QPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLN
GQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Nucleotide Sequence Data (823 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGATTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAG
Genomic Sequence Data (1265 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGATTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAGGTCCTCACTGAAGCTTCTCTCTCTGGAGCCTGAAGTAGTGATGAGTAGTCTGGGCCC
TGGGTGAGGTAAAGGACATTCATGAGGTCAATGTTCTGGGAATAACTCTCTTCCCTGATCCTTGGAGGAGCCCGAACTGA
TTCTGGAGCTCTGTGTTCTGAGATCATGCATCTCCCACCCATCTGCCCTTCTCCCTTCTACGTGTACATCATTAATCCCC
ATTGCCAAGGGCATTGTCCAGAAACTCCCCTGAGACCTTACTCCTTCCAGTCCCAAATCATTTACTTTTCTGTGGTCCAG
CCCTACTCCTATAAGTCATGATCTCCAAAGCTTTCTGTCTTCCAACTGCAGTCTCCACAGTCTTCAGAAGACAAATGCTC
AGGTAGTCACTGTTTCCTTTTCACTGTTTTTAAAAACCTTTTATTGTCAAATAAAATGGAGATAC

IMGT/HLA

Sponsors

Animated Sponsors Logo