Allele Report for DOB*01:01:01:01

DOB*01:01:01:01 View HGVS Report
Pre-2010 Nomenclature: DOB*01010101 Local Names: DOB*0101101, DO, pII-b-9
IMGT/HLA Acc No: HLA01098 OMIM Entry: *600629
Assigned: 1999-09-09 Sequence Last Modified: 2011-04-08
Source Entries: AB035249 , AL669918 , M26040 , X03066  
Cells Sequence Derived From: 45.1 , LCL721 , SA , SPL  
Known Ethnic Origin Of Source: American Indian, Oriental
CWD v2.0 Status: Not defined
Publications
Naruse TK et al. Tissue Antigens 59:512-9 2002. (View abstract)
Jonsson AK et al. Immunogenetics 29:411-3 1989. (View abstract)
Tonnelle C et al. EMBO J 4:2839-47 1985. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLG
QPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLN
GQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Nucleotide Sequence Data (823 bps)
ATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCGACTGGATTCCTCCATGACTCAAGGCAC
AGACTCTCCAGAAGATTTTGTGATTCAGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGG
TCAGATTCATCTTTAACTTGGAGGAGTATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGG
CAGCCAGATGCTGAGCAGTGGAACAGCCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACA
CAACTACAGGCTGGGCGCACCCTTCACTGTGGGGAGAAAAGTGCAACCAGAGGTGACAGTGTACCCAGAGAGGACCCCAC
TCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGATCAAGTGGTTCCTGAAT
GGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTCAGACTGTGGTGATGCT
AGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGCCCTGTTTCTGTGGAGT
GGAGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCTACTTGGGCTAATCTTCCTTCTG
GTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGATATGTGAGGACGCAGATGTCTGGTAATGAGGTCTCAAGAGCTGT
TCTGCTCCCTCAGTCATGCTAAG
Genomic Sequence Data (4786 bps)
CATAATAAACAGTCTGCCTAGTTCTTCTAGGGCCCCATAATATGTCAAACATATATTTTTACTTCTTCTCCCAGCCCATT
TTTAGTATACCTAAATTACTGTCAGTGATTCTGCAGGCAAACAATGGTTGAGTTGTATGACACAACTTTGTGAAAGTATC
CTACCCAGTACCTGATGATGCAAAACTCTTCTATCTTGATTGGTTGTCAATCTGAGGAGTTTCCAATCCTGGGGAAGCCA
GAAAAACAGCGATTTATACTCTTAATGGGTACTTTCTGACTGAATTTTATGAGCTCATTCTGAAGAGGCTGACGATTTTA
CTATCTCATTTTTTTCCTTTCTCCAGAATGGGTTCTGGGTGGGTCCCCTGGGTGGTGGCTCTGCTAGTGAATCTGACCCG
ACTGGATTCCTCCATGACTCAAGGCACAGACTCTCCAGGTAAGAACAGAGCAATTGTTTTTTTCCAGTGTGTATGCAAGA
ATTGGCATGGGGGAGTGATGCCTTTCTTTGTAAGTCCAGGCCACAGACCAGACTGGAAGTGGCTTTTGGTTTCAAAGAAC
AGTGTTCTTCCCTTTGGCAGAAAGGTACGCCTTGCCTCTTTACATGGGATGGACTTCATATACCAGAGCCACCTATTCAA
GGGGTAGGGAGGCAGGAAGAGGGAAACATTGTGTCTTGTTTAGGATCCTTATTGTGTGTATCAACCTCAGTCAGTGCCTG
GGCGTGTTGAAGGCCTTGGCTTGGGTTCGAGCCTGCTGGGAGAAACAACCTGCAGTAGGCTGGGTCACAGAGGCAATCTG
TGATTTTTTGGTCAGGACACGGAAACAAATCTCAGTTGGGGTATATGTGGACAAATGAAACTGGAAACAAAGGTTGCTCC
TTCTGTCATTTATTAAGCCACTATTATATTGTCAGAATTGTACTAAACAGTTTTGAGAAGTAAGAGAAGTTGAATAGAAT
ACATTGTCCTTGTCCTCCGGCTACCAGGTACAAGTTACTTGTCACTGTTATTTTTCTAGCACAGGTGACAGAATATGCAG
CCATGAAGCAATGTGAGATGAAAGCACATATTAATGAGCAGAAACAGGATGTAATGTGCTAAGAACAGAATCCCCTTTGC
ATGTTAGTTTCATTAAATACAAAAGAGGAACAAACCTGGCCAGGAGAGATCATTATTCTCAGAGAATAGAAACCGCCCTG
AGTTTATAATGTCCATTAAACAATACAACTGAAAAAAAAATCAGCACAGATGTTAAATGATGATGAAAAATTCAGATTTC
CCCCCTGGTTTAGACTACTAGAGGAAATAGAGAAGAGTATACATGCTGAGAAATTACAGGCTGGAACTTCATCTGAAATT
AGCTACTGAGTGAGGGATAAGTGGGGTTCACCCAGGAAGGTCATTCTTATGGCTCAGTTCAGAGTTGGAGGAGGCTTCTG
AACTTAGAAAGGAAAGTAAATTACAACCCAACATTAATAGCAATTATCTTTCAAGTCTTGACTTAGATGCAATGTCTTCA
GGACGTCCTTCCTGACTTACCTACATTATTAACTCCATTTGAATTTCCTTTTTATTGTAGTTGTTGTTCTTAAGTGCATA
GGATTGGTTTAATTTTACCCAATGAGTTCACAGCACATTGTAATTATTGGCAGTAGTGCAAGACTCTCTCGTCTCTTCTC
TTGCCTCCGTTCTCATTCTCTCCCCTCCCTAGAGAATCCATTCTAAACGTGTCTGGTAAGTCTCTAAGTATGAGAGTGGC
TTTTAGAAATATGTAGCATTATTGCTCTTTATGTGTTTTTAAAATTTAATAAATGTCATTCTCTGTTGAATCCCATTCTG
TTTCTTTTCTCACTTGACACTGTGCTTTTTGAGCATACTGAGGTCAAAGGCCTCCTCTTAGATCCATGTGGTCTGACGTA
ATTTACCAGGCATGGGTTTTCCCAGAGGAGGGGGCTGGTTCATGGTTTTGGTTTTGGTTTTCCAGAAGATTTTGTGATTC
AGGCAAAGGCTGACTGTTACTTCACCAACGGGACAGAAAAGGTGCAGTTTGTGGTCAGATTCATCTTTAACTTGGAGGAG
TATGTACGTTTCGACAGTGATGTGGGGATGTTTGTGGCATTGACCAAGCTGGGGCAGCCAGATGCTGAGCAGTGGAACAG
CCGGCTGGATCTCTTGGAGAGGAGCAGACAGGCCGTGGATGGGGTCTGTAGACACAACTACAGGCTGGGCGCACCCTTCA
CTGTGGGGAGAAAAGGTGAGCTGGAAGCTGAGGTCTGGCGGGGCTCAGGAATGTCCCCCATGTGAACCTGGCCATGGCTC
TTCTTTCTTACAAGCAATTTTCTGCTTTAGGATAAATGGTTGTCTGTGTAGATGTTCTGGCCCCAGCTGTGATATATTAT
CCTCACAAGTCAGCCACTGTGATCTTGGTCTCAGACCCCCAAGGTTCTCAGGGACTTCGAGGGCTATTGTGCCCTCAAAG
AGAAGCAGTAATTGTGGGAGTACCTCAGAAAGTCTAAATCCTCCTGACAGGCATTGACATACCCTGTTACTGATCTTGGG
GGCTGAGACTTGCCTATACTTTGTGTTCACTTGGGTGATCTGGGAAAGAGATTAGACATAGTGATAGTCCCTAAAGAATC
TCCTGTCCCAGCTTGGTGGTTTTCTTTCACGGTGTCTCATTTTTCCTCCCTTCCTAGTGCAACCAGAGGTGACAGTGTAC
CCAGAGAGGACCCCACTCCTGCACCAGCATAATCTGCTGCACTGCTCTGTGACAGGCTTCTATCCAGGGGATATCAAGAT
CAAGTGGTTCCTGAATGGGCAGGAGGAGAGAGCTGGGGTCATGTCCACTGGCCCTATCAGGAATGGAGACTGGACCTTTC
AGACTGTGGTGATGCTAGAAATGACTCCTGAACTTGGACATGTCTACACCTGCCTTGTCGATCACTCCAGCCTGCTGAGC
CCTGTTTCTGTGGAGTGGAGTGAGAATTAGTTTCTAGTACTCTCTGGGCCTGACTCAGGACTATACTGACTCAATACAGA
GCCTGTGTCACTTCTGCGTTTATCTTGGTCACAACATGAATTATTCTTTCCCTTGATCTGGGACAGTCACAGAAACCAGA
GTCCTTGGGTTAGGGTGGGAGAAAACATGGCAGATATCTATCCTCATATCTTCCAAGAAATGAGGAGATCTAATCACCTC
ATTATGTGCTTCCAACCCTATGAACTGGTGTCCTCTAATTCTTTGGTCTTAGTATTTAGGAGGCATTCTTATGGGCTGTG
AGAATCTGTAACCGATGGGGGGTAACTCCATGGGTGCCAACTTTGGTTTCGAAGAACCTTTTCTAAATTTATTTATTTTT
CTCTAGCTAGCATTGGATTTGGTGTCTAGTACAGATTCTGGGATTCCAAGAAAGTGCTTTAAATATTGGGATATTTTTAC
TAATTTAAAGACCTGTTTCCCATAGGAGCTCAGTCTGAATATTCTTGGAGAAAGATGCTGAGTGGCATTGCAGCCTTCCT
ACTTGGGCTAATCTTCCTTCTGGTGGGAATCGTCATCCAGCTAAGGGCTCAGAAAGGTAATGAGCCTGTGAGGAGTGCCC
TGCCACCTGTCCCAGACCTTCCCCACTCCCACCTTCCCTAACGTCAATGATCTGAGGCAAGGAAAGCTGATTGTGCCTCT
CAGGGATCACCGGGATAATTTTTTTCTGAAGCTAGAAATGGGATAAGCAGAGAGAGTGCTGACCTTGCCAGCCATTTGTT
CTTCCCTCGGGATAATCATATTGGGTCCTAATTGGGGCAATCCATTCTTTTCTCGATTTCTTTCCAGGATATGTGAGGAC
GCAGATGTCTGGTAATGAGGTAATGTCTCTTTTTCCTTGTCTTTGAGTGGCAGATCATTCTCCCGGTTCTTTGGCCAGAG
GGAGATGACATGGGGGTAGGGAGGAGTAAGGTTGCTGCTGTCTGGATGGGACTGTCCCCTGAGTCTCTGGAACGGCTGTG
GGGGGTGGTGAGGCTGCCTCCTGAGACCTTCATCACTGTGCCTCCAGGTCTCAAGAGCTGTTCTGCTCCCTCAGTCATGC
TAAGGTCCTCACTGAAGCTTCTCTCTCTGGAGCCTGAAGTAGTGATGAGTAGTCTGGGCCCTGGGTGAGGTAAAGGACAT
TCATGAGGTCAATGTTCTGGGAATAACTCTCTTCCCTGATCCTTGGAGGAGCCCGAACTGATTCTGGAGCTCTGTGTTCT
GAGATCATGCATCTCCCACCCATCTGCCCTTCTCCCTTCTACGTGTACATCATTAATCCCCATTGCCAAGGGCATTGTCC
AGAAACTCCCCTGAGACCTTACTCCTTCCAGCCCCAAATCATTTACTTTTCTGTGGTCCAGCCCTACTCCTATAAGTCAT
GATCTCCAAAGCTTTCTGTCTTCCAACTGCAGTCTCCACAGTCTTCAGAAGACAAATGCTCAGGTAGTCACTGTTTCCTT
TTCACTGTTTTTAAAAACCTTTTATTGTCAAATAAAATGGAGATACAAAAAATGTACATTTTAGTGAATTATTTAAGAAA
AACCCCTGTAATCAAGTCAAGGAACAGGACTTTGCCAGCTCCAGCGGAAGTCTCTGTACGTCAGGCCAATCAAAGCCTCT
CCTTCCCCTCGAAAGTGACCATATCCTGATTTTATTGTAACCTCTTTCATGTCTTTGTAGTCTAGTCCCCCAGGTATGTG
TTCCTGGACGCCACAGCTTAGTTGTCTTTTACGTCTCTCATACTTCACTGGTTTCTCCCCCATCAG

IMGT/HLA

Sponsors

Animated Sponsors Logo