Allele Report for DOA*01:01:04:01

DOA*01:01:04:01 View HGVS Report
Pre-2010 Nomenclature: DOA*01010401 Local Names: DOA*0101401, DNA1.3a
IMGT/HLA Acc No: HLA00997 OMIM Entry: *142930
Assigned: 1998-11-25 Sequence Last Modified: 2011-04-08
Source Entries: AB005996 , BX005422  
Cells Sequence Derived From: U937  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Naruse TK et al. Tissue Antigens 53:359-65 1999. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (250 aa)
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARF
DPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQ
TSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
Nucleotide Sequence Data (753 bps)
ATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGCCACCAA
GGCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATG
AGGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTT
GACCCGCAGGGCGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAG
AGCCATCAACGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAGCCCAACATCCTCATCTGCA
TCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTACGCAACGGCCAAACTGTCACTGAGGGAGTGGCCCAG
ACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGCCCTCAGCCGAGGACGTCTA
TGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGAGCTCCAGGTGCCTATTCCACCACCAG
ATGCCATGGAGACCCTGGTCTGTGCCCTGGGCCTGGCCATCGGCCTGGTGGGCTTCCTCGTGGGCACCGTCCTCATCATC
ATGGGCACATATGTGTCCAGTGTCCCCAGGTAA
Genomic Sequence Data (3653 bps)
AGCTGCGCGGTGCTCTGACGGCCTTTTCTCTCTCTTCAGGGGGTCCCTTCTTGGAGGACGTGGTAATAGTTGGTCCAAGC
CCCTCCCATCCTCCAAAACTTCCTTTGGCCTCTCCTGGGGGCCCAGTGAATCCTTCCACCTTCTCACCCCGGCTCTTTCC
CTCTTTACCCAGCAACAGATACATTCACTCAGAGAATTTCTGTGATTGGCTGAAGACAGCAGGGGTCGCCCCCATCCTCG
AATCTGTTTTCTTCTTCTTTACCTCCGCCTTGTTCCTGTCCTCACCACACGGACTGAGACTGATTTGATTAAAGCACCAG
AGTGTAATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGC
CACCAAGGGTGAGTGCGAGGGCGAGGAGGGTGCGGCGGGGAGCAGAGATTTACGGAGTTGGGTTACATGAGGAGGTGGCA
TGGAGGATGCTTGTTCCTCTCGCTCTCTGGTTTATGGGCAACTTCCTTCACCAAGAGACACCCAATCCCCCTCATCTCTG
TCACATCCACTCTGGACCTAAATGAAGATGCAGCTCGGTCAGCTGCGCAGGTGCCCCAGTCAGCCTTTGCTGACGTTCAG
ATTTCTCCTCATTCCTTCCTCCTTCCTGAGACCCAAACCTCCACCCAACAGATGCCAGCAAGCACCCTGATTTCTCTACC
ACCCCTGGCCGGGAATGTGCCCGATCAAGTCCAGTTCTGTTGCAGTATTTATGCCCATGCCGGTAGTTAACTATTTACCT
GTCTTTGTTCTTCGGGAGACATGAGCTGGGGTGCGGGTCTACAGATGGTTCATCTTTTTTTTCTTTTATTTCCCTGGCCC
ACCATTGTGCTGGGTGCATGCTAGTTCCTCAATAACTGTTGCTCAAACAACTTCATAGAGTTCTACAAGAATTAAAACTT
AATCCCTAACTTCCAGAAAACTAGACAACAGTTATGGAAGAGCCACACTCAGTCATAATGCTCTGAGATGGAGGAATTGG
GACATGAACCTTGACTTCTGACTCCTCGTCCAGTGCTCTTTGTAATGCCTTGAGTTGCCTCTCCCTATCCCCTTGGTCTC
TGGGTCACTAACCTTAATTCTTACCCCTGCCAGCCGTGGCCTGTTTCCCCTCACACCCACCTGCACTGCATCTCTGTGCA
AAGCTCCATACTCTCCTGTCCTTAATCATTCCTCCTCATCCCACCCCCACAGTCCCACCAGCTCACAACACAGGGCCTGA
CAACACAGCCAGGGCAGATGACCACAGCCAAGATTTAAATTCTGGAACCCCAAGCATGATTTTAGGCAGTCCCTCCTCTT
CCCATCCTGATATGCCAGACTGCACTGTCTCTGTGCCGACTGCAGTGTGCTGGGATGAGCCTCTTTCTTCCTGTTCTCTC
TCCCTTTCTCTCTCCCAGGGCCAGCCCAGTGTCAGAACAGGACTCTGTCCCCACACAGAACCCAGGACGGGGCCCAGGCT
CAGGGACTCAACAATCACATATTGTGGATGAGACAGACACATTTTTTTCTCTCTCCTTGACCCTGAACTCGCCAAACACA
GCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATGA
GGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTTG
ACCCGCAGGGCGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAGA
GCCATCAACGGTACCGGCCCTCCCTCTGCCCACCCAGTCAGGCGGGAAGGTCCAGAGAAACTTCCTCCCAGTTCCTAGGC
TCCCATCACTCTGGGGCGCGGTCTCAGCGCCCGCGCCTGTCATGCCCTGTTCCTTTCTTTCCCAGGAGGCTCCAGGTCTT
CCCAGACCCCTTTGGCACCCCTCTCCTTGAGGAATGACACCTCTCACCCGGACTCCCGCCCGGGGACCAGTCAAATATAG
GAGCTCCTGGCGTCCCCACTCCCTCCCCAGTCTCCTCTCCCTCTGTTTCCCTCCTCTCCTGCCCCAGTGGATACCCCAGA
GCATCCCCTGCCCACAGATGGCTACAAAGGGGGAACGTCCCTTAATCCCAGTCCTAGTAAGGCCCTGGGGTGAGGGATGA
GCCTGTGGACTCAGGGCCCGTTCCTCCTAGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAG
CCCAACATCCTCATCTGCATCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTACGCAACGGCCAAACTGT
CACTGAGGGAGTGGCCCAGACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGC
CCTCAGCCGAGGACGTCTATGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGGTACGGAG
CCCCCTCCCCATGCACCCTCCTGGCCCCAGGTTTCCTTTACTCTAGAATCCTTTCATATACCACCGACTCCTTCCTTTCT
CTCCTAGAGCTCCAGGTGCCTATTCCACCACCAGATGCCATGGAGACCCTGGTCTGTGCCCTGGGCCTGGCCATCGGCCT
GGTGGGCTTCCTCGTGGGCACCGTCCTCATCATCATGGGCACATATGTGTCCAGTGTCCCCAGGTGCAGAGGCCCCAGGA
GTCTGGGGGGTGGGGGAGGAAAGTGGATGACTCTGAACAGGACGTGGGTGGAGAATCAGAGATTCTGTTGTGGGGAAAGA
AGTCAGAAAAGAAATGGGCAGGGAGAAAAGAAGCAGAGGTGGGGTGAGAGAGTGAGGTTTTGGGGGAGGTGGGCACTCAG
AGATAGGATCCCAGCATATTGAAATTGAGCAACCTCGATCGTATGTTTTCTGCTATTTTAGGTAATGATCCTTCTGAGAG
AAATGACTTGTGGGAGACACCCTGCAGATCCTCATGGGTTTGTGACAGCCCCTGCGTGCTCAGTGCCCTTTAAGTGCATC
CCGCTGTGCTGACTTTGAGTGGGATCAACATCTGTCCTACGGGTCCCCTCTTTTTTGGCCCCAGTATTCATGGCAGGGTT
TGTTGGACACCTACTAGCTTCCCTTCCCATTCAACACAAACACACATTCTTGCTCTACCCAAAGCTCTGGCTGGCAGCAC
TAAATGCTTTGGTGGTGTTTGCACTGTGTCCTTTCCAGGCCTTGGCCAGTTCTTCCAGGGGTGAGGCATGTGGTGCTGGG
GATTGGCAGCCGTCCTGGGGCCCACACAGGTGTGTCTTGCTCCATTTGGCCCATTGTGTGTTACTTTGTGAATGAGCCAT
TTCACATGGACTTCATGAAATTTGCCTCCTGAGTTCAGGTTTACCCTGAAAGGGATGCAGATTATCCTGTTCCTCACGAC
CCCCTCAGCTAACAACAGTTCTGAAGGGTGCTGGGACAAGACAGGCTCATGGGGACTCCACTCCTGCCTGGGTTTACTCT
GTATGAAGAGGCCACTGGTATCCTGCCATGATGTTATCTCCTTTTTCTACTTT

IMGT/HLA

Sponsors

Animated Sponsors Logo