Allele Report for DOA*01:01:03

DOA*01:01:03 View HGVS Report
Pre-2010 Nomenclature: DOA*010103 Local Names: DOA*01013, DNA1.2b
IMGT/HLA Acc No: HLA00996 OMIM Entry: *142930
Assigned: 1998-11-25 Sequence Last Modified: 2011-04-08
Source Entries: AB005995  
Cells Sequence Derived From: DKB  
Known Ethnic Origin Of Source: Caucasoid
Publications
Naruse TK et al. Tissue Antigens 53:359-65 1999. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (222 aa)
DHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRA
INVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFVPSAEDVYD
CQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLIIMGTYVSSVPR
Nucleotide Sequence Data (671 bps)
CTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATGAG
GAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTTGA
CCCGCAGGGTGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAGAG
CCATCAACGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAGCCCAACATCCTCATCTGCATC
GTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTACGCAACGGCCAAACTGTCACTGAGGGAGTGGCCCAGAC
CAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGCCCTCAGCCGAGGACGTCTATG
ACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGAGCTCCAGGTGCCTATTCCACCACCAGAT
GCCATGGAGACCCTGGTCTGTGCCCTGGGCCTGGCCATCGGCCTGGTGGGCTTCCTCGTGGGCACCGTCCTCATCATCAT
GGGCACATATGTGTCCAGTGTCCCCAGGTAA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo