Allele Report for DOA*01:01:02:02

DOA*01:01:02:02 View HGVS Report
Pre-2010 Nomenclature: DOA*01010202 Local Names: DOA*0101202, PGDZ1, DNA1.1a
IMGT/HLA Acc No: HLA00496 OMIM Entry: *142930
Assigned: 1998-11-25 Sequence Last Modified: 2011-04-08
Source Entries: AB005991 , AL645931 , CR759795 , M31525  
Cells Sequence Derived From: PGF , SA  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Naruse TK et al. Tissue Antigens 53:359-65 1999. (View abstract)
Young JA et al. Immunogenetics 31:386-8 1990. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (250 aa)
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARF
DPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQ
TSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
Nucleotide Sequence Data (753 bps)
ATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGCCACCAA
GGCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATG
AGGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTT
GACCCGCAGGGCGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAG
AGCCATCAACGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAGCCCAACATCCTCATCTGCA
TCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTGCGCAACGGCCAAACTGTCACTGAGGGAGTGGCCCAG
ACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGCCCTCAGCCGAGGACGTCTA
TGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGAGCTCCAGGTGCCTATTCCACCACCAG
ATGCCATGGAGACCCTGGTCTGTGCCCTGGGCCTGGCCATCGGCCTGGTGGGCTTCCTCGTGGGCACCGTCCTCATCATC
ATGGGCACATATGTGTCCAGTGTCCCCAGGTAA
Genomic Sequence Data (3653 bps)
AGCTGCGCGGTGCTCTGACGGCCTTTTCTCTCTCTTCAGGGGGTCCCTTCTTGGAGGACGTGGTAATAGTTGGTCCAAGC
CCCTCCCATCCTCCAAAACTTCCTCTGGCCTCTCCTGGGGGCCCAGTGAATCCTTCCACCTTCTCACCCCGGCTCTTTCC
CTCTTTACCCAGCAACAGATACATTCACTCAGAGAATTTCTGTGATTGGCTGAAGACAGCAGGGGTCGCCCCCATCCTCG
AATCTGTTTTCTTCTTCTTTACCTCCGCCTTGTTCCTGTCCTCACCACACGGACTGAGACTGATTTGATTAAAGCACCAG
AGTGTAATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGC
CACCAAGGGTGAGTGCGAGGGCGAGGAGGGTGCGGCGGGGAGCAGAGATTTACGGAGTTGGGTTACATGAGGAGGTGGCA
TGGAGGATGCTTGTTCCTCTCGCTCTCTGGTTTATGGGCAACTTCCTTCACCAAGAGACACCCAATCCCCCTCATCTCTG
TCACATCCACTCTGGACCTAAATGAAGATGCAGCTCGGTCAGCTGCGCAGGTGCCCCAGTCAGCCTTTGCTGACGTTCAG
ATTTCTCCTCATTCCTTCCTCCTTCCTGAGACCCAAACCTCCACCCAACAGATGCCAGCAAGCACCCTGATTTCTCTACC
ACCCCTGGCCGGGAATGTGCCCGATCAAGTCCAGTTCTGTTGCAGTATTTATGCCCATGCCGGTAGTTAACTATTTACCT
GTCTTTGTTCTTCGGGAGACATGAGCTGGGGTGCGGGTCTACAGATGGTTCATCTTTTTTTTCTTTTATTTCCCTGGCCC
CCCATTGTGCTGGGTGCATGCTAGTTCCTCAATAACTGTTGCTCAAACAACTTCATAGAGTTCTACAAGAATTAAAACTT
AATCCCTAACTTCCAGAAAACTAGACAACAGTTATGGAAGAGCCACACTCAGTCATAATGCTCTGAGATGGAGGAATTGG
GACATGAACCTTGACTTCTGACTCCTCGTCCAGTGCTCTTTGTAATGCCTTGAGTTGCCTCTCCCTATCCCCTTGGTCTC
TGGGTCACTAACCTTAATTCTTACCCCTGCCAGCCGTGGCCTGTTTCCCCTCACACCCACCTGCACTGCATCTCTGTGCA
AAGCTCCATACTCTCCTGTCCTTAATCATTCCTCCTCATCCCACCCCCACAGTCCCACCAGCTCACAACACAGGGCCTGA
CAACACAGCCAGGGCAGATGACCACAGCCAAGATTTAAATTCTGGAACCCCAAGCATGATTTTAGGCAGTCCCTCCTCTT
CCCATCCTGATATGCCAGACTGCACTGTCTCTGTGCCGACTGCAGTGTGCTGGGATGAGCCTCTTTCTTCCTGTTCTCTC
TCCCTTTCTCTCTCCCAGGGCCAGCCCAGTGTCAGAACAGGACTCTGTCCCCACACAGAACCCAGGACGGGGCCCAGGCT
CAGGGACTCAACAATCACATATTGTGGATGAGACAGACACATTTTTTTCTCTCTCCTTGACCCTGAACTCGCCAAACACA
GCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATGA
GGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTTG
ACCCGCAGGGCGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAGA
GCCATCAACGGTACCGGCCCTCCCTCTGCCCACCCAGTCAGGCGGGAAGGTCCAGAGAAACTTCCTCCCAGTTCCTAGGC
TCCCATCACTCTGGGGCGCGCTCTCAGCGCCCGCGCCTGTCATGCCCTGTTCCTTTCTTTCCCAGGAGGCTCCAGGTCTT
CCCAGACCCCTTTGGCACCCCTCTCCTTGAGGAATGACACCTCTCACCCGGACTCCCGCCCAGGGACCAGTCAAATATAG
GAGCTCCTGGCGTCCCCACTCCCTCCCCAGTCTCCTCTCCCTCTGTTTTCCTCCTCTCCTGCCCCAGTGGATACCCCAGA
GCATCCCCTGCCCACAGATGGCTACAAAGGGGGAACGTCCCTTAATCCCAGTCCTAGTAAGGCCCTGGGGTGAGGGATGA
GCCTGTGGACTCAGGGCCTGTTCCTCCTAGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAG
CCCAACATCCTCATCTGCATCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTGCGCAACGGCCAAACTGT
CACTGAGGGAGTGGCCCAGACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGC
CCTCAGCCGAGGACGTCTATGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGGTACGGAG
CCCCCTCCCCATGCACCCTCCTGGCCCCAGGTTTCCTTTACTCTAGAATCCTTTCATATACCACCAACTCCTTCCTTTCT
CTCCTAGAGCTCCAGGTGCCTATTCCACCACCAGATGCCATGGAGACCCTGGTCTGTGCCCTGGGCCTGGCCATCGGCCT
GGTGGGCTTCCTCGTGGGCACCGTCCTCATCATCATGGGCACATATGTGTCCAGTGTCCCCAGGTGCAGAGGCCCCGGGA
GTCTGGGGGGTGGGGGAGGAAAGTGGATGACTCTGAACAGGACGTGGGTGGAGAATCAGAGATTCTGTTGTGGGGAAAGA
AGTCAGAAAAGAAATGGGCAGGGAGAAAAGAAGCAGAGGTGGGGTGAGAGAGTGAGGTTTTGGGGGAGGTGGGCACTCAG
AGATAGGATCCCAGCATATTGAAATTGAGCAACCTCGATCGTATGTTTTCTGCTATTTTAGGTAATGATCCTTCTGAGAG
AAATGACTTGTGGGAGACACCCTGCAGATCCTCATGGGTTTGTGACAGCCCCTGCGTGCTCAGTGCCCTTTAAGTGCATC
CCGCTGTGCTGACTTTGAGTGGGATCAACATCTGTCCTACGGGTCCCCTCTTTTTTGGCCCCAGTATTCATGGCAGGGTT
TGTTGGACACCTACTAGCTTCCCTTCCCATTCAACACACACACACATTCTTGCTCTACCCAAAGCTCTGGCTGGCAGCAC
TAAATGCTTTGGTGGTGTTTGCACTGTGTCCTTTCCAGGCCTTGGCCAGTTCTTCCAGGGGTGAGGCATGTGGTGCTGGG
GATTGGCAGCCATCCTGGGGCCCACACAGGTGTGTCTTGCTCCATTTGGCCCATTGTGTGTTACTTTGTGAATGAGCCAT
TTCACATGGACTTCATGAAATTTGCCTCCTGAGTTCAGGTTTACCCTGAAAGGGATGCAGATTATCCTGTTCCTCACGAC
CCCCTCAGCTAACAACAGTTCTGAAGGGTGCTGGGACAGGACAGGCTCATGGGGACTCCACTCCTGCCTGGGTTTACTCT
GTATGAAGAGGCCACTGGTATCCTGCCATGATGTTATCTCCTTTTTCTACTTT

IMGT/HLA

Sponsors

Animated Sponsors Logo