Allele Report for DOA*01:01:01

DOA*01:01:01 View HGVS Report
Pre-2010 Nomenclature: DOA*010101 Local Names: DOA*01011, DNA1.2a, DZa
IMGT/HLA Acc No: HLA00494 OMIM Entry: *142930
Assigned: 1998-11-25 Sequence Last Modified: 2011-04-08
Source Entries: AB005994 , CR759829 , CR936909 , X02882 , Z81310  
Cells Sequence Derived From: DBB , JG , MOU  
Known Ethnic Origin Of Source: Caucasoid
Publications
Naruse TK et al. Tissue Antigens 53:359-65 1999. (View abstract)
Trowsdale J et al. EMBO J 4:2231-7 1985. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (250 aa)
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARF
DPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQ
TSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
Nucleotide Sequence Data (753 bps)
ATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGCCACCAA
GGCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATG
AGGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTT
GACCCGCAGGGTGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAG
AGCCATCAACGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAGCCCAACATCCTCATCTGCA
TCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTACGCAACGGCCAAACTGTCACTGAGGGAGTGGCCCAG
ACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGCCCTCAGCCGAGGACGTCTA
TGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGAGCTCCAGGTGCCTATTCCACCACCAG
ATGCCATGGAGACCCTGGTCTGTGCCCTGGGTCTGGCCATCGGCCTGGTGGGCTTCCTCGTGGGCACCGTCCTCATCATC
ATGGGCACATATGTGTCCAGTGTCCCCAGGTAA
Genomic Sequence Data (3653 bps)
AGCTGCGCGGTGCTCTGACGGCCTTTTCTCTCTCTTCAGGGGGTCCCTTCTTGGAGGACGTGGTAATAGTTGGTCCAAGC
CCCTCCCATCCTCCAAAACTTCCTTTGGCCTCTCCTGGGGGCCCAGTGAATCCTTCCACCTTCTCACCCCGGCTCTTTCC
CTCTTTACCCAGCAACAGATACATTCACTCAGAGAATTTCTGTGATTGGCTGAAGACAGAAGGGGTCGCCCCCATCCTCG
AATCTGTTTTCTTCTTCTTTACCTCCGCCTTGTTCCTGTCCTCACCACACGGACTGAGACTGATTTGATTAAAGCACCAG
AGTGTAATGGCCCTCAGAGCAGGGCTGGTCCTGGGGTTCCACACCCTGATGACCCTCCTGAGCCCGCAGGAGGCAGGGGC
CACCAAGGGTGAGTGCGAGGGCGAGGAGGGTGCGGCGGGGAGCAGAGATTTACGGAGTTGGGTTACATGAGGAGGTGGCA
TGGAGGATGCTTGTTCCTCTCGCTCTCTGGTTTATGGGCAACTTCCTTCACCAAGAGACACCCAATCCCCCTCATCTCTG
TCACATCCACTCTGGACCTAAATGAAGATGCAGCTCGGTCAGCTGCGCAGGTGCCCCAGTCAGCCTTTGCTGACGTTCAG
ATTTCTCCTCATTCCTTCCTCCTTCCTGAGACCCAAACCTCCACCCAACAGATGCCAGCAAGCACCCTGATTTCTCTACC
ACCCCTGGCCTGGAATGTGCCCGATCAAGTCCAGTTCTGTTGCAGTATTTATGCCCATGCCGGTAGTTAACTATTTACCT
GTCTTTGTTCTTCGGGAGACATGAGCTGGGGTGCGGGTCTACAGATGGTTCATCTTTTTTTTCTTTTATTTCCCTGGCCC
CCCATTGTGCTGGGTGCATGCTAGTTCCTCAATAACTGTTGCTCAAACAACTTCATAGAGTTCTACAAGAATTAAAACTT
AATCCCTAACTTCCAGAAAACTAGACAACAGTTATGGAAGAGCCACACTCAGTCATAATGCTCTGAGATGGAGGAATTGG
GACATGAACCTTGACTTCTGACTCCTCGTCCAGTGCTCTTTGTAATGCCTTGAGTTGCCTCTCCCTATCCCCTTGGTCTC
TGGGTCACTAACCTTAATTCTTACCCCTGCCAGCCGTGGCCTGTTTCCCCTCACACCCACCTGCACTGCATCTCTGTGCA
AAGCTCCATACTCTCCTGTCCTTAATCATTCCTCCTCATCCCACCCCCACAGTCCCACCAGCTCACAACACAGGGCCTGA
CAACACAGCCAGGGCAGATGACCACAGCCAAGATTTAAATTCTGGAACCCCAAGCATGATTTTAGGCAGTCCCTCCTCTT
CCCATCCTGATATGCCAGACTGCACTGTCTCTGTGCCGACTGCAGTGTGCTGGGATGAGCCTCTTTCTTCCTGTTCTCTC
TCCCTTTCTCTCTCCCAGGGCCAGCCCAGTGTCAGAACAGGACTCTGTCCCCACACAGAACCCAGGACGGGGCCCAGGCT
CAGGGACTCAACAATCACATATTGTGGATGAGACAGACACATTTTTTTCTCTCTCCTTGACCCTGAACTCGCCAAACACA
GCTGACCACATGGGCTCCTACGGACCCGCCTTCTACCAGTCTTACGGCGCCTCGGGCCAGTTCACCCATGAATTTGATGA
GGAACAGCTGTTCTCTGTGGACCTGAAGAAAAGCGAGGCCGTGTGGCGTCTGCCTGAGTTTGGTGACTTTGCCCGCTTTG
ACCCGCAGGGTGGGCTGGCCGGCATCGCCGCAATCAAAGCCCATCTGGACATCCTGGTGGAGCGCTCCAACCGCAGCAGA
GCCATCAACGGTACCGGCCCTCCCTCTGCCCACCCAGTCAGGCGGGAAGGTCCAGAGAAACTTCCTCCCAGTTCCTAGGT
TCCCATCACTCTGGGGCGCGCTCTCAGCGCCCGCGCCTGTCATGCCCTGTTCCTTTCTTTCCCAGGAGGCTCCAGGTCTT
CCCAGACCCCTTTGGCACCCCTCTCCTTGAGGAATGACACCTCTCACCCGGACTCCCGCCCAGGGACCAGTCAAATATAG
GAGCTCCTGGCGTCCCCACTCCCTCCCCAGTCTCCTCTCCCTCTGTTTCCCTCCTCTCCTGCCCCAGTGGATACCCCAGA
GCATCCCCTGCCCACAGATGGCTACAAAGGGGGAACGTCCCTTAATCCCAGTCCTAGTAAGGCCCTGGGGTGAGGGATGA
GCCTGTGGACTCAGGGCCCGTTCCTCCTAGTGCCTCCACGGGTGACCGTGCTCCCCAAGTCTCGGGTGGAGCTGGGCCAG
CCCAACATCCTCATCTGCATCGTGGACAACATCTTCCCCCCTGTGATCAATATCACCTGGCTACGCAACGGCCAAACTGT
CACTGAGGGAGTGGCCCAGACCAGCTTCTATTCCCAGCCTGACCATTTGTTCCGCAAGTTCCACTACCTGCCCTTCGTGC
CCTCAGCCGAGGACGTCTATGACTGCCAGGTGGAGCACTGGGGCCTGGATGCGCCACTCCTCAGGCATTGGGGTACGGAG
CCCCCTCCCCATGCACCCTCCTGGCCCCAGGTTTCCTTTACTCTAGAATCCTTTCATATACCACCGACTCCTTCCTTTCT
CTCCTAGAGCTCCAGGTGCCTATTCCACCACCAGATGCCATGGAGACCCTGGTCTGTGCCCTGGGTCTGGCCATCGGCCT
GGTGGGCTTCCTCGTGGGCACCGTCCTCATCATCATGGGCACATATGTGTCCAGTGTCCCCAGGTGCAGAGGCCCCGGGA
GTCTGGGGGGTGGGGGAGGAAAGTGGATGACTCTGAACAGGACGTGGGTGGAGAATCAGAGATTCTGTTGTGGGGAAAGA
AGTCAGAAAAGAAATGGGCAGGGAGAAAAGAAGCAGAGGTGGGGTGAGAGAGTGAGGTTTTGGGGGAGGTGGGCACTCAG
AGATAGGATCCCAGCATATTGAAATTGAGCAACCTCGATCGTATGTTTTCTGCTATTTTAGGTAATGATCCTTCTGAGAG
AAATGACTTGTGGGAGACACCCTGCAGATCCTCATGGGTTTGTGACAGCCCCTGCGTGCTCAGTGCCCTTTAAGTGCATC
CCGCTGTGCTGACTTTGAGTGGGATCAACATCTGTCCTACGGGTCCCCTCTTTTTTGGCCCCAGTATTCATGGCAGGGTT
TGTTGGACACCTACTAGCTTCCCTTCCCATTCAACACAAACACACATTCTTGCTCTACCCAAAGCTCTGGCTGGCAGCAC
TAAATGCTTTGGTGGTGTTTGCACTGTGTCCTTTCCAGGCCTTGGCCAGTTCTTCCAGGGGTGAGGCATGTGGTGCTGGG
GATTGGCAGCCGTCCTGGGGCCCACACAGGTGTGTCTTGCTCCATTTGGCCCATTGTGTGTTACTTTGTGAATGAGCCAT
TTCACATGGACTTCATGAAATTTGCCTCCTGAGTTCAGGTTTACCCTGAAAGGGATGCAGATTATCCTGTTCCTCACGAC
CCCCTCAGCTAACAACAGTTCTGAAGGGTGCTGGGACAAGACAGGCTCATGGGGACTCCACTCCTGCCTGGGTTTACTCT
GTATGAAGAGGCCACTGGTATCCTGCCATGATGTTATCTCCTTTTTCTACTTT

IMGT/HLA

Sponsors

Animated Sponsors Logo