Allele Report for DMB*01:06

DMB*01:06 View HGVS Report
Pre-2010 Nomenclature: DMB*0106 Local Names: None
IMGT/HLA Acc No: HLA01083 OMIM Entry: *142856
Assigned: 1999-07-28 Sequence Last Modified: 1999-08-06
Source Entries: AF072680 , AF134890  
Cells Sequence Derived From: CC44  
Known Ethnic Origin Of Source: Oriental
Publications
McTernan CL et al. Tissue Antigens 55:470-3 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (188 aa)
GFVAHVESTCLLDDAGTPKDFTYCIFFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCAT
HTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSEHKTAQPNGDWTYQTLSH
LALTPSYGDTYTCVVEHTGAPEPILRDW
Nucleotide Sequence Data (567 bps)
GTGGCTTCGTGGCCCATGTGGAAAGCACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTTC
TTCAACAAGGATCTGCTGACCTGCTGGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAATAGCTT
GGCGAATGTCCTCTCACAGCACCTCAACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGCTTCAGAATTGTGCCA
CACACACCCAGCCCTTCTGGGGATCACTGACCAACAGGACACGGCCACCATCTGTGCAAGTAGCCAAAACCACTCCTTTT
AACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTCTATCCAGCAGAAGTGACTATCACGTGGAGGAAGAA
CGGGAAGCTTGTCATGCCTCACAGCAGTGAGCACAAGACTGCCCAGCCCAATGGAGACTGGACATACCAGACCCTCTCCC
ATTTAGCCTTAACCCCCTCTTACGGGGACACTTACACCTGTGTGGTAGAGCACACTGGGGCTCCTGAGCCCATCCTTCGG
GACTGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo