Allele Report for DMB*01:04

DMB*01:04 View HGVS Report
Pre-2010 Nomenclature: DMB*0104 Local Names: DM3.4
IMGT/HLA Acc No: HLA00492 OMIM Entry: *142856
Assigned: 1993-09-06 Sequence Last Modified: 1998-12-16
Source Entries: U00700  
Cells Sequence Derived From: CEPH 23-01  
Known Ethnic Origin Of Source: Unknown
Publications
Carrington M et al. Immunogenetics 38:446-9 1993. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (80 aa)
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSVHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAP
Nucleotide Sequence Data (242 bps)
CAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTCTATCCAGCAGAAGTGACTA
TCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGCAGTGTGCACAAGACTGCCCAGCCCAATGGAGACTGGACA
TACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGGGGACACTTACACCTGTGTGGTAGAGCACACTGGGGCTCC
TG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo