Allele Report for DMB*01:01:01:01

DMB*01:01:01:01 View HGVS Report
Pre-2010 Nomenclature: DMB*0101 Local Names: RING7
IMGT/HLA Acc No: HLA00489 OMIM Entry: *142856
Assigned: 1993-08-10 Sequence Last Modified: 1999-08-06
Source Entries: BX908719 , BX927138 , Z23139  
Cells Sequence Derived From: JY , MOU  
Known Ethnic Origin Of Source: Caucasoid
Publications
Kelly AP et al. Nature 353:571-3 1991. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (263 aa)
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHL
NQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHS
SAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGWHIS
Nucleotide Sequence Data (792 bps)
ATGATCACATTCCTGCCGCTGCTGCTGGGGCTCAGCCTGGGCTGCACAGGAGCAGGTGGCTTCGTGGCCCATGTGGAAAG
CACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTCCTTCAACAAGGATCTGCTGACCTGCT
GGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAATAGCTTGGCGAATGTCCTCTCACAGCACCTC
AACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGCTTCAGAATTGTGCCACACACACCCAGCCCTTCTGGGGATC
ACTGACCAACAGGACACGGCCACCATCTGTGCAAGTAGCCAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGG
CCTGCTATGTGTGGGGCTTCTATCCAGCAGAAGTGACTATCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGC
AGTGCGCACAAGACTGCCCAGCCCAATGGAGACTGGACATACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGG
GGACACTTACACCTGTGTGGTAGAGCACATTGGGGCTCCTGAGCCCATCCTTCGGGACTGGACACCTGGGCTGTCCCCCA
TGCAGACCCTGAAGGTTTCTGTGTCTGCAGTGACTCTGGGCCTGGGCCTCATCATCTTCTCTCTTGGTGTGATCAGCTGG
CGGAGAGCTGGCCACTCTAGTTACACTCCTCTTCCTGGGTCCAATTATTCAGAAGGATGGCACATTTCCTAG
Genomic Sequence Data (6740 bps)
CTAGTAACTGATGATGCTAGGCTGAGGCACTCAGTGATTTGTCTCTACATTTGTCCCTGCCTACCTAGCCAATCTGTCCC
TGTTTGGGACACTGGACTCCCGTGAGCTGGAAGGAACAGATTTAATATCTAGGGGCTGGGTATCCCCACATCACTCATTT
GGGGGGTCAAGGGACCCGGGCAATATAGTATTCTGCTCAGTGTCTGGAGATCATCTACCCAGGCTGGGGCTTCTGGGACA
GGCGAGGACCCACGGACCCTGGAAGAGCTGGTCCAGGGGACTGAACTCCCGGCATCTTTACAGAGCAGAGCATGATCACA
TTCCTGCCGCTGCTGCTGGGGCTCAGCCTGGGCTGCACAGGAGCAGGTAAGGACACTTCTTCTGGGGACTCTCCCTTCCC
CTGCTCCTGTTTCAGGGTAAGGGTGTTCCGTTTTGTAATTGCATTTGACACCCCAGATAGTTTGTCTCCCTGGTATACAT
TCCTATAGCACTTTGTACTTTGTAGCAATTTTAATGTAATTAATCTGTATAATTATCTGTGCAGTGTATATTCCCTGCTG
GAATATAGGCAAGGACAATGTTCATCTTATTTATTGCTGCCTCCTCAGCTCCTAGCACAGTGCCTTGCATGCAGCAAGTG
CTTCATAAATATGTGCGAAGTGAATATTTAATATTTCCAGCACAATACAAGGCTGACTCTTTCTCTTGACCCTTTTTCTC
TCTCAATAATTTGCCTTACTGAAGGTCTGTGTTCTGGGCAAATTGTCATGTTTAAACATGCAAATAATCTCGGGGGGCTA
CTCCTATCCCTGTGCTTAGTCTTGCATAAAGAGGAGACTGGATCTAAAAACTTATCTACTACTTCTACTGACTCCCTCAA
ATCAGACTTTCAGAAACTTCAGTGTATGAGCTTGGTCAGTAGATGTTCCCTGAGCAGGAAATCTGTGCCAGACTAGCTGG
ATGTCACCAAGGCTTAGGTTCTGAGCTGAATATAGGAAAAATCAACTTTTTTTCTTCTATATGCTCACACTCAACACTTC
TTTGACCAACTGTGTGAGGTTTTTTTTTTTTTTTTACTCATACCAACCAATTCTCCTATATTAGCTGGATATCCTATAAT
TCAATTCCATTGTGACATTAACTAGAGTTAACATAGACACCAAAGGTTAAAGACTCAGTCCCATAAGACTGCCTCCATTT
CAGACACCAATCACAAGTAGTAGGTTCCCAAATTACCCACATCTTCTGTCCAACTTGCCTACAAATCAGAGGTTCCCATG
ACCCCCTCCTTGGGGTTGGTAATTTGCTAAAGTGGCTTATGGAACTCAGGAAAAGTTTACTTATTATTGTAGATTTTTTA
CAAAGGATATTTTAATTGATAATAATAATTATAAATATTCATGGGGTGGATAATGATGTTTTAGTACATGTAATGTACAG
TGATCAGATCAGATCATCATCTCATTTATCATTTCTTTGTGTTGGAAACATTCCATATCCTTCTTCTAGCGATTTGAAAT
GATATAAAGTATTATTGTTAATGACAGTCATCCCACAGTGGTATAGAACACTAGATCATAATTTTGCATCCTTTAACAAA
GGATATTTTAAAGCATACAAAGGAACATCCAGATGAAGAGATACCAGATCTGGAAGGGTCCCAATCACAGGAGCTCTGTC
CCCACAGAATTGGGGTACTTCACCTCCTGGCATGTGGATGTGTTTACCAACTGAGAAGTTCTCTGAACTCCATAGTTCCG
GGATTTTTATGGAGGCTTCATCATGTAGGCATGACTGATTATTAACTCAATCTCCAGCCCCTTCCCCTTCAGGGAGTATG
GGGGATGGGACTAAAAGTTCCAGACTTCTAATCATGACTTGGTCTTTCTGGTGACCAGCCCCTCCTGCAGGAGCCCACCA
AGAGTACCTCATTAGAACAAAAGACACTCCTGTTATCTAGGAAATTCTAAGCGATTAGGCACTCTATGTCAGGAACCAGG
GTCAAAGACAAAGCTCTGTGCAGAGCTCCTAAATATACGTCTGTATGTTTTATATATTTATTATTTGTGTATATTTATTA
TTTATATATTTATTTATTTATTGCCAGGCCAGTAGAAGACATTGACCTGTTCTCCCTTCCCTGGCTCCTCTAGGTGGCTT
CGTGGCCCATGTGGAAAGCACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTCCTTCAACA
AGGATCTGCTGACCTGCTGGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAATAGCTTGGCGAAT
GTCCTCTCACAGCACCTCAACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGCTTCAGAATTGTGCCACACACAC
CCAGCCCTTCTGGGGATCACTGACCAACAGGACACGTGAGGAGAGAGGGGTGCAGAGGGGCTACCAGGAAGTGCAGTTAG
GAGGGCAGGCCAGGGAGGATCCCACAGTGGCCCAGGGGTTTGAGATTTGAGCAGCAAATAAGAGAAAATGTGTGGATCTG
AAATGTAGAAAGACGGAGGATTGAACCTCAAGGGGAACAAGGTGGCTGACGTGAGTGGAACAGGAGTAAAGAAGGGGAGG
TGAGGCTTGAACCGCGAGGTGCCATGTGGGGAGCTTATGCAGAGGCTGGGGCATCTCAGGATGCATACCCAAGATGTTCT
TGCCTTGTTATCCCAGATTTTGATGTTCCAGATCTGATGTGGGCCCAGGCATGGGAATATTTGGAATCCCAGGGGATTCT
GACACATGCTTTTTCTCACCCTTAAACTCTTGCATTGACAATGGCTTGAAGTTTGTGAAAGTAAACTTGAAGATCTCCAC
AGTACAGAACAGTGTGTCTCAAGGGTGGTTTCTGAACCACCTTTCTCAGAATTGCCTGGAGGAGGTGCTTGTTAAAGATG
CAAGCCCCTTAGTACCACTCCAGATCTGTTGAAAGAAAGTATCTGGGGATACAGCCTAGGAAATCTGCATTTTAACATAA
TTCCTTGGATTTTTATTTAAGATTGTGTTTGAAAAATGTCAAGATAGAGGCAAGCAAGAGGATCACCTAGGAGAGTAAAT
TAGTAAAAGATGGCAGTATTAGCAATCTCTTTAGTTTGACTACATTCATTCCAAATTTAAGAGTGAGTCCTAAGTTAGGC
TTGTTTCCTTGAACTATGTGAGGAGAAAAAGCTTTAACTAGCAAAAGAACGTATTAAACAAGATTTGGAGAAAAATTCCT
TTTCCACCTTAAAAAAACCCAATGTACAACTCTGGATTACTCTTAGCTTCCTTATTTCAAATACTTTCCAGTTTATGTAC
TTGAAATAAATACAACAACTTCTAGAACAGCTTGCAGTTCAGATCTGGCTTTTACTAATTGTAATCAAACATAATTCTGG
AGGAGGAAAGAAAGAAAGGGGCAATGAAGGAATGGGAGAGAAGAAAGAGTAATGCAGGAATACATTCTAACGGTTCCCCT
TCAAGGGGCAGCATGGCAGAGGGGGCTGGGGTGGAAAGTGGGTTGCAAAATCTACGAAGAGTTGCGATAGGGAAGAAACC
AGGTTGAGGAAGCAGCCAGAATGTCACCCTCCTTCCTAAACATGTTTTTTTCTCCTATGCAGGGCCACCATCTGTGCAAG
TAGCCAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTCTATCCAGCAGAAGTG
ACTATCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGCAGTGCGCACAAGACTGCCCAGCCCAATGGAGACTG
GACATACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGGGGACACTTACACCTGTGTGGTAGAGCACATTGGGG
CTCCTGAGCCCATCCTTCGGGACTGGAGTAAGTGTATGGCAGATGGATGGAATTAGGGTCAAAGCAGAGAAAATGAGATG
TGGATCGATACATGGTACATGGTAGACAGCGAAGTGCTGAAAATGGGGACTGAGTCTGGAGGAACTTACGGGGGGCTTAG
GACCAGAATGGGGAAATGGGATAAAGAAATGGAAATATTTAGGTTGGTGCAAAAGTAATTGCAGTTTTTGCCATTACTTT
CAGTGGCAAAAACCGCAATTACTTTTGCACCAGTTTAATATTTAGTCTGTGCTATTGCTGCTCTGGTGGTGTGGTTGATG
TTGCTGCGTCTATGTTTGAGGGTGAGAGGGGAGCGTGCTTGCTTTGAAATGAGGATGTAAATTTGGCAATCATATTTTCA
GAACCCCAAATTGTAATACACTATTCTAGCCTCCTTAGATTTCAACTATTCTGGTGCCAGAAGCAGATGGGAGCTGAAGG
AATGATGAAGGTTGAAGAAGGGGGGCTTTTCTTGGTGTGGGGCAGTACTGCATTTGGCCTGCTCTACCAAGCATACGGGA
GTAGTAAAGCCACGGCTGGCAGACCATTTGGCATGCATGCTCAGGGGCCAGTGGATAAAGAATTACTTACAGTTCAAACA
CTGTTTGAACTCAGTGTCGGGAGTAGTTAAAGGTATCGTGAGAAGTTGCACACAGCTTTGGGGACTCTTGGAAAAGAAAG
AGGAAGAAATGAGGAAGAGGAAGGGTGTCTACAAAGGGCCAGAGAACAGGATCTCAGATCAGCTGCTGTAACCAGGTTTC
CCCTTGTGGGAAGTGTTGTTTCTTGCTGGGCAGTTGGGAAGGGAATGGAGAACAGAGAAGAGAGTGGAAATCACATGCTC
ACTTGAACTTTCCTGGGGAACGTCTCCTCACAGCGTGCACAAGAGCCTCCCTTTAGAAATGGAGTGTTCATTTTATCATG
GGAAAAGAATCTGAGTGGGACATGATTCAGAACAGGACCGGCCCAAGGAAGTGCAGGGGCTGTGGAGTGGGATGGAGACA
AGCTCTGAAAGGACACATGGGAGATCTAGATGTAGAAGGTACACAAGTAGTAGGATAACTCACAGGATGGATCCACTGGA
GGTTAAGACATGTGGTAAGACAGTGTAATAGGAAGCTGCTCAGTTGGAGAAAGTAAGGAAGCAAACATTGTTACCGTGGG
GGCAATGGAGAGGACAGTGAGGAGCCCTTTATCCTGATAAGGGTGGCTTTGAGGTAAAGGAAGGAAAGAGGATGCCTTGA
GAGGCCCCACTGTATTAGAGAGGACCTGGAAGCCAGGATGCTAATTCTGGGGAGATGGATTCCCCAGGCTTACTCTAGGA
GTAGAGGTCCATGGGACGAGGGTTTGATTTGAGAAAGATCATTTTCTTGGGAGTGGGTGGTGTGAGCTAGACCCTTGGAG
CTGGGATAAAGGACCTTTTAACCCACTGAGAGGTGGCTGCAATAAATGGAATTGCCCTGGGGGTGAGCAACAGAAACTGG
GTCAAGTAAGTTTCTATTTTTTGCAGCACCTGGGCTGTCCCCCATGCAGACCCTGAAGGTTTCTGTGTCTGCAGTGACTC
TGGGCCTGGGCCTCATCATCTTCTCTCTTGGTGTGATCAGCTGGCGGAGAGCTGGCCACTCTAGTGAGTGACTCGCTGAA
CTCCCATCCCCACTCTTGGTCCCACTCTCTGCTTACTTTCTGTTTGTGATTAACTCTCTCCTTCCTACTGCATTTGCTAT
GAATACTGCTAGATATTTTCATCCACAAAGACTGGTATAATCAAGTATCTTCCTCTCTTAGGTTACACTCCTCTTCCTGG
GTCCAATTATTCAGAAGGTAACATCTCTGTTGGTCTGTTTCCCTACTTGCCCTTTGGTAGGGGTGCGGGTTAGAGGGGTC
AGTGTTGGGTTCAACTAATCTTGATTATTATATGGGTGAGCTTCCATGAGGATCTAGGCAAGGGCATGATTTAAGCTGCC
ATTGCTAGGATTAAGAGCAGGAAGGAGCATCCTCCTCTTCTACCAAGTGGGATGTCTGTGGAGAGGAGGCTGAAGGTGCT
TCCTTTGTATTAGTTGTTGGTGCCCTGGAGTTTTCAGTATCACTGTATTAAGGCATGGGATGGTTACAGTGACAAACGAT
GGGGGCAAGTTGGGTTGAAGCCTCATTATCTCCCTTTTATTTATTCTGTAGGATGGCACATTTCCTAGAGGCAGAATCCT
ACAACTTCCACTCCAAGTGAGAAGGAGATTCAAACTCAATGATGCTACCATGCCTCTCCAACATCTTCAACCCCCTGACA
TTATCTTGGATCCTATGGTTTCTCCATCCAATTCTTTGAATTTCCCAGTCTCCCCTATGTAAAACTTAGCAACTTGGGGG
ACCTCATTCCTGGGACTATGCTGTAACCAAATTATTGTCCAAGGCTATATTTCTGGGATGAATATAATCTGAGGAAGGGA
GTTAAAGACCCTCCTGGGGCTCTCAGTGTGCCATAGAGGACAGCAACTGGTGATTGTTTCAGAGAAATAAACTTTGGTGG
AAATATTGTTTTTCCATGTCTTCTTCCTGGGGCCCTGGGGAAGGAATATGGGCAAAGCAGGGACTGAGGTTAATTCTCTT
CTGCTTGAGTAGGGGAGAAATCAATGCCTTCTTCCATTTTCCCACTTAGACATGACAGAATTTGGGGCCGTTTTCTGATT
TATAATTCATAAGGAGAAATTCAACTGTGGTGGGTTGGAGTCACAGAGTATGGGCAAGGAAGGGAATTAACAGCTTACTC
ACCTCATACAGGATCTTATG

IMGT/HLA

Sponsors

Animated Sponsors Logo