Allele Report for DMA*01:04

DMA*01:04 View HGVS Report
Pre-2010 Nomenclature: DMA*0104 Local Names: DMA3.4
IMGT/HLA Acc No: HLA00488 OMIM Entry: *142855
Assigned: 1994-02-08 Sequence Last Modified: 1998-12-16
Source Entries: U04877  
Cells Sequence Derived From: BM21  
Known Ethnic Origin Of Source: Caucasoid
Publications
Carrington M et al. Immunogenetics 40:165-165 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (93 aa)
GFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSIPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIV
THEIDCYTAIAYW
Nucleotide Sequence Data (279 bps)
GGGTTTCCTATCGCTGAAGTGTTCACGCTGAAGCCCCTGGAGTTTGGCAAGCCCAACACTTTGGTCTGTTTTGTCAGTAA
TCTCTTCCCACCCATGCTGACAGTGAACTGGCAGCATCATTCCATCCCTGTGGAAGGATTTGGGCCTACTTTTGTCTCAG
CTGTCGATGGACTCAGCTTCCAGGCCTTTTCTTACTTAAACTTCACACCAGAACCTTCTGACATTTTCTCCTGCATTGTG
ACTCACGAAATTGACTGCTACACAGCAATTGCCTATTGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo