Allele Report for C*17:01:01:02

C*17:01:01:02 View HGVS Report
Pre-2010 Nomenclature: Cw*17010102 Local Names: HLA-C
IMGT/HLA Acc No: HLA04311 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: GQ472844 , HG794384  
Cells Sequence Derived From: 7550800440 , SHJO  
Known Ethnic Origin Of Source: Black, Oriental
CWD v2.0 Status: Not defined
Publications
Xu Y et al. Tissue Antigens 78:102-114 2011. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (372 aa)
MRVMAPQALLLLLSGALALIETWAGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAV
LAVLAVLAVLGAVVAAVIHRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1119 bps)
ATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCTCTCGGGAGCCCTGGCCCTGATCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCG
GACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGA
GTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACGCCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAACAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCT
GCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTCCTGGCTGTC
CTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTCAGGTGGAAA
AGGAGGGAGCTGCTCTCAGGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3368 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCTGGGTCTCAAGCTCCCAGGGCCGTGTCTGCATTGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATAC
TCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTACGCAGTCCCGGTTC
TGAAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCT
CTCGGGAGCCCTGGCCCTGATCGAGACCTGGGCCGGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGCG
AGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGG
GCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTG
GAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCG
GAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCAGCCCGGGGCGCAGGTCACGACCCCTCCCCATC
CCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCTCCCCGAGGCTGCGGAACCCGCCCAGACCCTCGA
CCGGAGAGAGCCCTAGTCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGGG
CGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
CGCTCCTGGACCGCGGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGAT
CAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCCGAGTTTCCTCTGAGGGCCCCGTCTGCTCT
CTAGGACAATTAAGGGATGAAGTCCCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTG
ACCACTTTGACCACTGCGGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAATGT
GTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCA
GAGACTAGAACTTTCCAAAGAATAGGAGATTATCCCAGGTCCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTC
CCTACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCGCAAGAGAGATACAAAGTGTCT
GAATTTTCTGACTCTTCCCGTCAGAACGCCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTG
AGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAAACTCAGGACAC
CGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAAC
AGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCTGCACCCTGAGATGGAGTAAGGAGGGGGATGAGGGG
TCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGTGTAAGGGCC
CCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTC
CTGGCTGTCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTC
AGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCC
ACCTCGTTACTGGAAGCACCATCCACACCTGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAA
GCACATGACAACGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCGTGAGTCAGGG
GAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCT
GCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTG
CCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTG
ATGGCGGTGGGCGTGTGGAGGAGCTCACCTACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCT
TTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGG
GGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATCCTTTGATTGGGACGTTTCGAGTGTG
TGGTGGACTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGAC
AGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCT
GCAAAGGCATCTGAATGTGTCTGCGTTCCTGTTAGCATAATATGAGGAGTTGGAGAGACAGCTCACCCCCGTGTCCACCG
TGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo