Allele Report for C*15:24

C*15:24 View HGVS Report
Pre-2010 Nomenclature: Cw*1524 Local Names: HIS_NEW_C_355_00339, HIS_NEW_C_478_00525
IMGT/HLA Acc No: HLA04598 OMIM Entry: *142840
Assigned: 2009-11-30 Sequence Last Modified: 2010-01-15
Source Entries: FJ765756 , FJ976807 , FJ998001 , GQ149324 , GQ161047 , GQ161063 , GQ180272 , GQ180399 , GQ180404 , GQ240514 , GQ345086 , GU187934 , GU811798 , HM004245 , JN123917 , JN124456 , JN205220 , JN205224  
Alignment of CDS Source Entries
C*01:02:01
C*15:24
Submission 1
Submission 2
Submission 3
Submission 4
Submission 5
Submission 6
Submission 7

Locus Reference
  Virtual entry for C*15:24 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: HG00000679 , HG00000680 , HG00001750 , HG00002146 , HG00002255 , HG00002583 , HG00003329 , HG00003330 , HG00003331 , HN-19931-9 , HN-20258-4 , HN-26317-4 , HN-28600-9 , HN-30608-6 , HN-34589-4 , HN-62237-3 , HN-69265-8 , HN-72722-4  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.4598 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 18 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRKL
RGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGAGAGCCCCACTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAACTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors