Allele Report for C*12:30

C*12:30 View HGVS Report
Pre-2010 Nomenclature: Cw*1230 Local Names: HIS_NEW_C_335_00246, HIS_NEW_C_493_00623, HIS_NEW_C_493_00625
IMGT/HLA Acc No: HLA04592 OMIM Entry: *142840
Assigned: 2009-11-30 Sequence Last Modified: 2010-01-15
Source Entries: FJ619437 , FJ976874 , FJ976876 , FJ997995 , GQ121342 , GQ149317 , GQ149335 , GQ401214 , GQ994085 , GU947093 , HM125884 , HM187708 , HM362826 , HM362846 , HM594800 , HQ215031 , HQ230512 , HQ337746 , HQ590464 , HQ644410  
Cells Sequence Derived From: HG00001024 , HG00001025 , HG00001561 , HG00001562 , HG00001563 , HG00001564 , HG00001565 , HG00001566 , HG00001567 , HG00001916 , HG10011922 , HN-20602-2 , HN-34323-7 , HN-40116-2 , HN-41317-1 , HN-62540-6 , HN-65522-5 , HN-69835-4 , HN-71816-8 , HN-81675-2  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWMEQEGPEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGATGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCTGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo