Allele Report for C*07:68

C*07:68 View HGVS Report
Pre-2010 Nomenclature: Cw*0768 Local Names: NT01039
IMGT/HLA Acc No: HLA03698 OMIM Entry: *142840
Assigned: 2009-03-31 Sequence Last Modified: 2009-04-17
Source Entries: FJ792498 , FJ797363 , FJ858901 , FJ858902 , FJ976822 , FJ998002 , GQ149302 , GQ180252 , GQ240505 , GQ240566 , GQ345090 , GQ345093 , GQ994073 , GQ994084 , GU017950 , HM562339  
Cells Sequence Derived From: HG00000655 , HG00000656 , HN-03908-0 , HN-08339-9 , HN-16429-0 , HN-28940-6 , HN-40383-4 , HN-53344-0 , HN-58361-9 , HN-58409-4 , HN-74665-8 , HN-76839-2 , HN-81747-5 , HN-91790-5 , NT01039  
Known Ethnic Origin Of Source: American Indian
Publications
Lazaro AM et al. Tissue Antigens 77:54-61 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 15 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQDRAYLE
GTCVEWLRRYLENGKKTLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo