Allele Report for C*07:52

C*07:52 View HGVS Report
Pre-2010 Nomenclature: Cw*0752 Local Names: US 050018879
IMGT/HLA Acc No: HLA03135 OMIM Entry: *142840
Assigned: 2007-09-25 Sequence Last Modified: 2007-10-05
Source Entries: AM850146  
Cells Sequence Derived From: US050018878  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (349 aa)
LALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQ
ADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARA
AEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVE
TRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRK
SSGGKGGSCSQAACSNSAQGSDESLITCK
Nucleotide Sequence Data (1049 bps)
CCTGGCCCTGACCGAGACCTGGGCCTGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAG
AGCCCCGCTTCATCTCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGG
GAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAACTACAAGCGCCAGGCACA
GGCTGACCGAGTGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGT
ATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCC
CTGAACGAGGACCTGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGC
GGCGGAGCAGCTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGC
TGCAGCGCGCAGAACCCCCAAAGACACACGTGACCCACCACCCCCTCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCC
CTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGA
GACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGT
GCCATATGCAGCACGAGGGGCTGCAAGAGCCCCTCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATG
GGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTCCTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAA
GAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCA
CTTGTAAAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo