Allele Report for C*07:02:10

C*07:02:10 View HGVS Report
Pre-2010 Nomenclature: Cw*070210 Local Names: HIS_NEW_C_229_00101, HIS_NEW_C_291_00164, HIS_NEW_C_335_00238, HIS_NEW_C_335_00239, DE HIS_NEW_C_381_00373, HIS_NEW_C_422_00415
IMGT/HLA Acc No: HLA04320 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ392217 , FJ594512 , FJ619429 , FJ619430 , FJ792489 , FJ875583 , GQ161070 , GQ161073 , GQ345075 , GQ345076 , GQ994089 , GU017943 , GU128018  
Cells Sequence Derived From: HG00000721 , HN-04243-6 , HN-04512-1 , HN-13035-6 , HN-16894-0 , HN-20592-7 , HN-25864-1 , HN-34565-8 , HN-45647-3 , HN-4640038 , HN-78126-6 , HN-86223-6 , HN-95859-1  
Known Ethnic Origin Of Source: Mixed
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 13 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCTGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo