Allele Report for C*07:02:05

C*07:02:05 View HGVS Report
Pre-2010 Nomenclature: Cw*070205 Local Names: HLA-C
IMGT/HLA Acc No: HLA03759 OMIM Entry: *142840
Assigned: 2009-04-30 Sequence Last Modified: 2009-07-17
Source Entries: FJ811898  
Cells Sequence Derived From: SZ-23  
Known Ethnic Origin Of Source: Oriental
Publications
Zou HY et al. Tissue Antigens 74:455-456 2009. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (366 aa)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVV
LAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATTACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGAACCCCCAAAGACACACGTGA
CCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCC
TCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTC
CTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGCCTGA
Genomic Sequence Data (2903 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTG
CGGGGTTGGGAGGGAAGCGGCCTCTGCGGAGAGGAGCGAGGGGCCCTCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGC
AGGGAGGTGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTC
CCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACG
CCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAG
TACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTG
ACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCATCCCCCACGGACGGCCCGGGTCGCCCAGAGTCTCCCCGTCTGAG
ATCCACCCCAAGGTGGATCTGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCGCCTTTACCCGGTTTCATT
TTCGGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGACTGGGCTGACCGCGGGGGCGGGGC
CAGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCC
GCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATTAC
CCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCA
GATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGAT
CTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGATCAGCACTGGAATATCGCCCTCCCTTGAATGGAGAATGG
CATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCTCTGAGGAAATGGA
GGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCTCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCT
GACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAATGTGTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTGCAG
CCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAG
GTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCGCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCAC
ATGGGCGCTGCTGGAGTGTCCCAAGAGAGATGCAAAGTGTCTGAATTTTCTGACTCTTCCCGTCAGAACCCCCAAAGACA
CACGTGACCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAA
GAGCCCCTCACCCTGAGCTGGGGTAAGGAGGGGAATGGGGGGTCACATCTCTTATCAGAGAAAGCAGAAGTCCTTCTGGA
GCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGGCCCCTCACCTTCTCCTCCTTTCCCAGAGCCATCTTCCCAG
CCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTCCTAGCTGTCCTTGGAGCTGTGGTCACCGC
TATGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAAGAGCGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTC
AAGCCCCAGGTAGAAGTGTGCCCCGCCTTGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTG
TGCCAGCACTTACTCTTTTGTGAAGCACATGTGACAATGAAGGACGGATGTATCACCTTGATGATTATGGTGTTGGGGTC
CTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGAACCCACAA
CTGCTTTCCCCATGTTTCCTGATCCTGCCCTGGGTCTGCAGTCGTAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGA
GGTTCCCCTAAGATCACATGGCCCTGCCTCCTCCCAGTCCCCTCATAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGG
AGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGCGGGCGTGTGGAGGAGCTCACCTACTCCATAATTCCTCTTGTCCCAC
ATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCAGGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCT
CATCACTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGAT
TCTTTGATTGGGACGTTTCGAGTGTGTGGTGGGCCGTTCAGAGTGTCATCGCTTACCATGACTGACCTGAATTTGTTCAT
GACTATTGTGTTCTGTAGCCTGA

IMGT/HLA

Sponsors

Animated Sponsors Logo