Allele Report for C*07:02:02

C*07:02:02 View HGVS Report
Pre-2010 Nomenclature: Cw*070202 Local Names: Cw*0702new
IMGT/HLA Acc No: HLA03232 OMIM Entry: *142840
Assigned: 2008-02-27 Sequence Last Modified: 2008-04-08
Source Entries: AM934701  
Cells Sequence Derived From: LUMC-C44  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JDH et al. Tissue Antigens 74:424-428 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Cw7 WHO Assigned Type: Cw7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 110 Cw7 [51-73%]
NMDP (2008) 976 Cw7 [68%] blank [14%]
13 IHWC (2002) 144 Cw7
Neural Network Assigned Type: Training - Cw7
Comments:
Protein Sequence (365 aa)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVV
LAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCK
Nucleotide Sequence Data (1096 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCAGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGAACCCCCAAAGACACACGTGA
CCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCC
TCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTC
CTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo