Allele Report for C*07:02:01:01

C*07:02:01:01 View HGVS Report
Pre-2010 Nomenclature: Cw*07020101 Local Names: Cw*0702101, JY, JY328, Cw7J1, Cw7.5
IMGT/HLA Acc No: HLA00434 OMIM Entry: *142840
Assigned: 1990-11-04 Sequence Last Modified: 1998-12-16
Source Entries: AJ293016 , AY603356 , D38526 , D49819 , FJ515904 , HM543702 , Z49112  
Cells Sequence Derived From: 08009370 , JY , KOK , P4487 , SAM , TID , WEHO  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Srivastava R et al. Immunol Rev 84:93-121 1985. (View abstract)
Wang H et al. Hum Immunol 45:52-8 1996. (View abstract)
Cox ST et al. Tissue Antigens 61:20-48 2003. (View abstract)
Zhu F et al. Int J Immunogenet 38:281-284 2011. (View abstract)
Xu Y et al. Tissue Antigens 78:102-114 2011. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 7 Laboratories: 7
HLA Dictionary Data
Expert Assigned Type: Cw7 WHO Assigned Type: Cw7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 110 Cw7 [51-73%]
NMDP (2008) 976 Cw7 [68%] blank [14%]
13 IHWC (2002) 144 Cw7
Neural Network Assigned Type: Training - Cw7
Comments:
Protein Sequence (366 aa)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVV
LAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGAACCCCCAAAGACACACGTGA
CCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCC
TCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTC
CTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGCCTGA
Genomic Sequence Data (3354 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCATTGGGGAGGCGC
CGCGTTGGGGATTCTCCACTCCCCTGAGTTTCACTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGACGC
GTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGTCCC
CAGTCACCCACCCGGACTCACATTCTCCCCAGAGGCCGAGATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCT
CGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTGGGAGGGAAGCGGCCTCTGCGGAGAGGAGCGAG
GGGCCCTCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGTGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCC
CAGGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGC
TACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGA
GCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGA
ACCTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCATCCC
CCACGGACGGCCCGGGTCGCCCAGAGTCTCCCCGTCTGAGATCCACCCCAAGGTGGATCTGCGGAACCCGCCCAGACCCT
CGACCGGAGAGAGCCCCAGTCGCCTTTACCCGGTTTCATTTTCGGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGG
GGCGGGGCTCGGGGGACTGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCT
GGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACC
TGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTG
AGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGG
TACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGG
ATCAGCACTGGAATATCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCT
CTCTAGGACAATTAAGGGATGAAGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCTCCTT
TGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAAT
GTGTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTGCAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCT
CAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCGCCT
TCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCCCAAGAGAGATGCAAAGTGT
CTGAATTTTCTGACTCTTCCCGTCAGAACCCCCAAAGACACACGTGACCCACCACCCCCTCTCTGACCATGAGGCCACCC
TGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGAC
ACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGA
GCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCCTCACCCTGAGCTGGGGTAAGGAGGGGAATGGGG
GGTCACATCTCTTATCAGAGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGG
CCCCTCACCTTCTCCTCCTTTCCCAGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTG
TCCTGGTTGTCCTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTG
AAGAGCGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCGCCTTGTTACTGGAAG
CACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGAAGCACATGTGACAATGA
AGGACGGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTA
AGGACAGACCTTAGGAGGGCAGTTGGTCCAGAACCCACAACTGCTTTCCCCATGTTTCCTGATCCTGCCCTGGGTCTGCA
GTCGTAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCACATGGCCCTGCCTCCTCCCAGTCC
CCTCATAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGCGGGCGT
GTGGAGGAGCTCACCTACTCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTA
CCCCAGGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGT
CGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATTCTTTGATTGGGACGTTTCGAGTGTGTGGTGGGCCGTTCA
GAGTGTCATCGCTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGG
GACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGA
ATGTGTCTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo