Allele Report for C*07:01:01:01

C*07:01:01:01 View HGVS Report
Pre-2010 Nomenclature: Cw*070101 Local Names: Cw*07011
IMGT/HLA Acc No: HLA00433 OMIM Entry: *142840
Assigned: 1989-08-01 Sequence Last Modified: 1999-04-08
Source Entries: AF015556 , AF015557 , AH006132 , AL662833 , D84394 , DQ249172 , DQ249174 , GQ472838 , HG794375 , HG794378 , M28207 , Y16418 , Z46810  
Cells Sequence Derived From: 7550800619 , CGM1 , COX , LCL721 , LK707 , MF , NM388 , PAT135 , PAT144  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Pohla H et al. Immunogenetics 29:297-307 1989. (View abstract)
Steinle A et al. Tissue Antigens 44:268-70 1994. (View abstract)
Turner S et al. J Immunol 161:1406-13 1998. (View abstract)
Nair RP et al. Am J Hum Genet 78:827-51 2006. (View abstract)
van der Vlies SA et al. Tissue Antigens 54:169-77 1999. (View abstract)
Xu Y et al. Tissue Antigens 78:102-114 2011. (View abstract)
Stewart CA et al. Genome Res 14:1176-87 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 9 Laboratories: 9
HLA Dictionary Data
Expert Assigned Type: Cw7 WHO Assigned Type: Cw7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 36 Cw7 [52-73%]
NMDP (2008) 304 Cw7 [74%] blank [20%]
13 IHWC (2002) 129 Cw7
Neural Network Assigned Type: Training - Cw7
Comments:
Protein Sequence (366 aa)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVV
LAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAACTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGAACCCCCAAAGACACACGTGA
CCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCC
TCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTC
CTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGCCTGA
Genomic Sequence Data (3354 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCATTGGGGAGGCGC
CGCGTTGGGGATTCTCCACTCCCCTGAGTTTCACTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGACGC
GTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGTCCC
CAGTCACCCACCCGGACTCACATTCTCCCCAGAGGCCGAGATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCT
CGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTGGGAGGGAAGCGGCCTCTGCGGAGAGGAGCGAG
GGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGTGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCC
CAGGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGC
TACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGA
GCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAACTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGA
ACCTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCATCCC
CCACGGACGGCCCGGGTCGCCCCGAGTCTCCCCGTCTGAGATCCACCCCAAGGTGGATCTGCGGAACCCGCCCAGACCCT
CGACCGGAGAGAGCCCCAGTCGCCTTTACCCGGTTTCATTTTCGGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGG
GGCGGGGCTCGGGGGACTGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCT
GGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACC
TGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTG
AGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGG
TACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGG
ATCAGCACTGGAATATCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCT
CTCTAGGACAATTAAGGGATGAAGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCTCCTT
TGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAAT
GTGTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTGCAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCT
CAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCGCCT
TCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCCCAAGAGAGATGCAAAGTGT
CTGAATTTTCTGACTCTTCCCGTCAGAACCCCCAAAGACACACGTGACCCACCACCCCCTCTCTGACCATGAGGCCACCC
TGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGAC
ACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGA
GCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCCTCACCCTGAGCTGGGGTAAGGAGGGGAATGGGG
GGTCACATCTCTTATCAGAGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGG
CCCCTCACCTTCTCCTCCTTTCCCAGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTG
TCCTGGTTGTCCTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTG
AAGAGCGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCGCCTTGTTACTGGAAG
CACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGAAGCACATGTGACAATGA
AGGACGGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTA
AGGACAGACCTTAGGAGGGCAGTTGGTCCAGAACCCACAACTGCTTTCCCCATGTTTCCTGATCCTGCCCTGGGTCTGCA
GTCGTAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCACATGGCCCTGCCTCCTCCCAGTCC
CCTCATAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGCGGGCGT
GTGGAGGAGCTCACCTACTCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTA
CCCCAGGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGT
CGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATTCTTTGATTGGGACGTTTCGAGTGTGTGGTGGGCCGTTCA
GAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGG
GACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCGTCTGA
ATGTGTCTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo