Allele Report for C*06:20

C*06:20 View HGVS Report
Pre-2010 Nomenclature: Cw*0620 Local Names: 1835-08
IMGT/HLA Acc No: HLA03624 OMIM Entry: *142840
Assigned: 2009-01-31 Sequence Last Modified: 2009-04-17
Source Entries: FM958448  
Cells Sequence Derived From: 1835-08  
Known Ethnic Origin Of Source: Unknown
Publications
Emmerich F et al. Tissue Antigens 76:425- 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKL
RGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo