Allele Report for C*05:10

C*05:10 View HGVS Report
Pre-2010 Nomenclature: Cw*0510 Local Names: Cw*05(233585)
IMGT/HLA Acc No: HLA01907 OMIM Entry: *142840
Assigned: 2004-04-30 Sequence Last Modified: 2004-07-08
Source Entries: AJ635297 , AJ635298 , EU972419  
Cells Sequence Derived From: 233585 , NT01000  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Well-Documented
Publications
Lebedeva TV et al. Tissue Antigens 65:101-6 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Cw5 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Cw5
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKL
RGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKKTLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGAC
CGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGG
Genomic Sequence Data (8881 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGAC
CGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/cgenomicl
ib:C_05:100GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCG
CAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCAGCGGGCGCCG
TGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAA
CCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTG
CGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAG
AGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYli
b/cgenomiclib:C_05:101GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCC
CCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGC
CGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACT
GACCGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGG
CTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGA
ATGAGGACCTGCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCG
GAGCAGCGGAGAGCCTACCTGGAGGACACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCA
GCGCGCGGYlib/cgenomiclib:C_05:102GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGC
CGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCC
AAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCC
AGGCACAGACTGACCGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAG
AGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTA
CATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGG
CCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAG
AAGACGCTGCAGCGCGCGGYlib/cgenomiclib:C_05:103GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGT
CCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGAC
GCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAA
GTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTC
ACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGAC
GGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAA
GTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGG
AGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/cgenomiclib:C_05:104GCTCCCACTCCATGAGGTATTTCTA
CACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGT
TCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGG
GAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGA
GGCCGGGTCTCACACCTTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGT
TCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATC
ACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCG
CAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/cgenomiclib:C_05:105GCTCCCACTCCATG
AGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCA
GTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGT
ATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAACTGCGCGGCTACTAC
AACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGG
GTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCGGACAAGG
CGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCGAGTGCGTG
GAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/cgenomiclib:C_05:106GCT
CCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTG
GACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGA
GGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAACTGC
GCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGC
CTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGC
CGCGGACACAGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGGAGG
GCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/cgenomiclib:
C_05:107GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAG
TGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGG
GTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCT
GCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTGTGGCTGCGACCTGGGGC
CCGACGGGCGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGC
TCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGC
CTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGYlib/c
genomiclib:C_05:108GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCG
CTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGC
GGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGAC
CGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTG
CGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATG
AGGACCTGCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAG
CAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCG
CGCGGAACACCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCT
TCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGG
CCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGT
GCAGCACAAGGGGCTGCCAGAGCCCCTCACCCTGAGATGGGYlib/cgenomiclib:C_05:109ATGCGGGTCATGGC
GCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGAGGTTGGGAGGG
AAACGGCCTCTGCGGAGAGGAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCG
GGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCG
GAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGA
GGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGC
ACAGACTGACCGAATGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGG
CGCAGGTCACGACCCCTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCACCCCGAGGC
TGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATC
CCCGCGGGTTGGTCGGGGCTGGGGCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGGTCTCACACCCTCC
AGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGAT
TACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGC
GGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGA
AGAAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATCTCCCGGGATGGCCTCCC
ACGAGGAGGGGAGGAAAATGGGATCAGCGCTGGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCTGAGTT
TCTTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTCCCTGG
AATACTGATCAGGGGTCCCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCT
TGTTCTCTGCCTCACGCTCAATGTGTTTAAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGA
CCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTG
GCGTCTGGGTTCTGTGCCCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCACTGTTGGAGTG
TCGCAAGAGAGATACAAAGTGTCTGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACCATCCC
GTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGA
TGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTG
TGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAGCCCCTCACCCTGAGA
TGGGGTAAGGAGGGGGATGAGGGGTCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCGGGTCAGGGC
TGAGGCTTGGGGGTCAGGGCCCCTCACCTTCCCCTCCTTTCCCAGGGCCATCTTCCCAGCCCACCATCCCCATCGTGGGC
ATCGTTGCTGGCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAG
CTCAGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGC
CCCACCTCGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCTAGCACTTACTCTGTTGT
GAAGCACATGACAATGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCATGAGTC
AGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGA
TCCTGCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGC
CCTGCCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTA
AGTGATGGCGGTGGGCGTGTGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAG
GTCTTTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATT
CTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATTGGGACGTTTCGAA
TGTGTGGTGAGCTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTG
A

IMGT/HLA

Sponsors

Animated Sponsors Logo