Allele Report for C*05:01:11

C*05:01:11 View HGVS Report
Pre-2010 Nomenclature: Cw*050111 Local Names: Cw*05new-329141
IMGT/HLA Acc No: HLA04391 OMIM Entry: *142840
Assigned: 2009-10-31 Sequence Last Modified: 2010-01-15
Source Entries: FN422380 , GQ180437 , GQ240469 , GQ240497 , GQ491094 , GU289900 , GU551875 , HQ214977 , HQ214978 , HQ230511 , HQ590478 , JN124375 , JQ277298 , JQ824493  
Cells Sequence Derived From: 329141 , HG00000766 , HG00000767 , HG00000768 , HG00000963 , HG00002108 , HG00002109 , HG00003159 , HG00005097 , HG00005098 , HN-10512-1 , HN-22060-8 , HN-42502-5 , HN-48688-5  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 14 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKL
RGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCAGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGAC
CGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGAACACCCAAAGACA
CACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCA
GAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo