Allele Report for C*05:01:08

C*05:01:08 View HGVS Report
Pre-2010 Nomenclature: Cw*050108 Local Names: HIS_NEW_C_340_00312, HIS_NEW_C_339_00289, HIS_NEW_C_371_00356, HIS_NEW_C_461_00487, DE HIS_NEW_C_461_00488, HIS_NEW_C_461_00492, HIS_NEW_C_461_00496, HIS_NEW_C_461_00498 DE HIS_NEW_C_461_00493
IMGT/HLA Acc No: HLA04296 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ614611 , FJ618922 , FJ765924 , FJ969925 , FJ969926 , FJ969930 , FJ969931 , FJ969934 , FJ969936 , GQ345073 , GQ449654 , GQ859556 , GQ859563 , GQ859564 , GU128049 , HQ258909 , HQ337728 , HQ590485  
Cells Sequence Derived From: HG00000964 , HG10011918 , HG10011919 , HN-04402-3 , HN-06390-8 , HN-26042-3 , HN-35804-0 , HN-3736-3 , HN-47132-3 , HN-47465-9 , HN-50218-6 , HN-62608-4 , HN-62913-6 , HN-65756-1 , HN-79718-7 , HN-80863-4 , HN-81198-4 , HN-N257957  
Known Ethnic Origin Of Source: Caucasoid, Mixed
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 18 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKL
RGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKKTLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGAC
CGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTTCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo