Allele Report for C*04:28

C*04:28 View HGVS Report
Pre-2010 Nomenclature: Cw*0428 Local Names: LUMC-C26
IMGT/HLA Acc No: HLA03007 OMIM Entry: *142840
Assigned: 2007-07-31 Sequence Last Modified: 2007-10-05
Source Entries: AM748048  
Cells Sequence Derived From: LUMC-C26  
Known Ethnic Origin Of Source: Caucasoid
Publications
Anholts JDH et al. Tissue Antigens 74:424-428 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFHPAEITLT
WQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAV
LAVLGAMVAVVMCRRKSS
Nucleotide Sequence Data (1015 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTCCACATCCGTGTCCTGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCCACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTTCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTATGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo