Allele Report for C*04:16

C*04:16 View HGVS Report
Pre-2010 Nomenclature: Cw*0416 Local Names: Cw*04MVE1204
IMGT/HLA Acc No: HLA02193 OMIM Entry: *142840
Assigned: 2005-05-31 Sequence Last Modified: 2005-07-12
Source Entries: AJ871635  
Cells Sequence Derived From: MHHZ-00013010 , MHHZ-00013011 , MHHZ-00013012  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Cw4 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Cw4
Comments:
Protein Sequence (206 aa)
MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (619 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo