Allele Report for C*04:09N

C*04:09N View HGVS Report
Pre-2010 Nomenclature: Cw*0409N Local Names: Cw4new
IMGT/HLA Acc No: HLA01451 OMIM Entry: *142840
Assigned: 2001-03-20 Sequence Last Modified: 2001-04-09
Source Entries: AF196489 , AF405691 , AJ515217 , AJ515489 , AJ617512 , JQ771790  
Cells Sequence Derived From: 10-5140 , 38279 , 38554 , CTM6991383 , LCL13W09501  
Known Ethnic Origin Of Source: Caucasoid
Publications
Lind C et al. Human Immunology 74:325-329 2013. (View abstract)
Balas A et al. Tissue Antigens 59:95-100 2002. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 -
NMDP (2008) 2 Blank [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (398 aa)
MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAV
LAVLGAMVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKPETAACVGLRCRISSHLSFVTSRASGISFCKGI
Nucleotide Sequence Data (1197 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTCCACATCCGTGTCCTGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTTCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTATGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAGCCTGAGACAGCTGCCTGTGTGGGAC
TGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCATCTGA
Genomic Sequence Data (2991 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTG
CGGGGTTGGGAGGGAAACGGCCTCTGGGGAGAGGAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGC
AGGGAGGAGGGTCGGGCGGGTCTCAGCCACTCCTCGTCCCCAGGCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTC
CTGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACG
CCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAG
TACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTG
ACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCCGTCTGAG
ATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAG
TTTAGGCCAAAATCCCCGCGGGTTGGTCGGGACTGGGGCGGGGCTCGGGGGACCGGGCTGACCACGGGGGCGGGGCCAGG
GTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCT
ACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAG
CGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATA
CCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCCGTAGATCTCC
CGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGATCAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATG
AGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGG
AAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACC
TTTCTCTCAGGCCTTGTTCTCTGCCTGACGCTCAATGTGTTTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTC
CACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGC
CTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGG
GCGCTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTCTGAATTTTCTGACTCTTCCCATCAGAACACCCAAAGACACACG
TGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTG
ACCTGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCA
GAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTTCAGCACGAGGGGCTGCCGGAGC
CCCTCACCCTGAGATGGAGTAAGGAGGGGGATGAGGGGTGATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTC
AGCCGGGTCAGGGCTGAGGCTTGGAGGTCAGGGCCCCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCA
TCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTATGGTGGCTGTTGTGATG
TGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTTCCACTGGGAGTTTCAAGCCCC
AGGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGC
ACTTACTCTGTTGTGAAGCACATGACAATGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCC
AGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTTCAGAACCCACAGCTGCTTTC
CCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCC
TAAGATCGCATGGCCCTGCCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTC
TCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTG
CGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTT
GTAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATT
GGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGT
GTTCTGTAGCCTGAGACAGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGC
CTCTGGCATCTCTTTCTGCAAAGGCATCTGA

IMGT/HLA

Sponsors

Animated Sponsors Logo