Allele Report for C*04:01:13

C*04:01:13 View HGVS Report
Pre-2010 Nomenclature: Cw*040113 Local Names: HIS_NEW_C_335_00243, HIS_NEW_C_378_00364, HIS_NEW_C_378_00371
IMGT/HLA Acc No: HLA04590 OMIM Entry: *142840
Assigned: 2009-11-30 Sequence Last Modified: 2010-01-15
Source Entries: FJ619434 , FJ765994 , FJ766001 , FJ997947 , FJ997996 , GQ121337 , GU017944 , GU128022 , GU354127 , HM467561 , HQ337735 , HQ644402 , JQ824453 , JQ824502 , JQ824516  
Cells Sequence Derived From: HG00001011 , HG00001788 , HG00002169 , HG00005135 , HG00005136 , HG00005137 , HG10011942 , HN-17952-4 , HN-26496-7 , HN-27574-4 , HN-39452-9 , HN-50859-7 , HN-68703-0 , HN-68911-4 , HN-73939-2  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 15 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKL
RGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCTGGCCCGGCCGTGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo