Allele Report for C*04:01:10

C*04:01:10 View HGVS Report
Pre-2010 Nomenclature: Cw*040110 Local Names: HLA-Cw*04
IMGT/HLA Acc No: HLA03805 OMIM Entry: *142840
Assigned: 2009-05-31 Sequence Last Modified: 2009-07-17
Source Entries: FJ392198 , FJ392201 , FJ392215 , FJ392225 , FJ489880 , FJ594519 , FJ614590 , FJ614600 , FJ619428 , FJ655417 , FJ765750 , FJ765921 , FJ765997 , FJ875621 , FJ875626 , FJ976853 , GQ161049 , GQ180259 , GQ180270 , GQ180388 , GQ254380 , GQ254388 , GQ401210 , GQ401217 , GQ449656 , GU128038  
Cells Sequence Derived From: HN-01633-5 , HN-03817-1 , HN-11404-8 , HN-13432-6 , HN-15468-3 , HN-22063-7 , HN-22340-3 , HN-24206-6 , HN-25425-2 , HN-28624-5 , HN-29226-6 , HN-41497-5 , HN-63809-2 , HN-63876-1 , HN-70551-5 , HN-74313-0 , HN-79793-7 , HN-80358-7 , HN-81046-9 , HN-81687-4 , HN-89705-7 , HN-92882-9 , HN-93035-2 , HN-94285-3 , HN-94570-0 , J-08-7194  
Known Ethnic Origin Of Source: Unknown
Publications
Thude H et al. Tissue Antigens 75:80-82 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 26 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKL
RGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCTGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACA
CACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTTCAGCACGAGGGGCTGCCG
GAGCCCCTCACCCTGAGATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo