Allele Report for C*04:01:08

C*04:01:08
Pre-2010 Nomenclature: Cw*040108 Local Names: HistoGenetics HIS_NEW_C_293_00190
IMGT/HLA Acc No: HLA03736 OMIM Entry: *142840
Assigned: 2009-03-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ594538 , FJ619422 , FJ875613 , FJ997950 , FJ997952 , FJ997982 , FN430727 , FN821963 , GQ180269 , GQ240500 , GQ401215 , GQ900576 , GQ900580 , GU017945 , GU128054 , GU289896 , GU551873 , HM159328 , HQ337745 , HQ590525  
Cells Sequence Derived From: 20090116062 , AKB-651323 , HG00001007 , HG00001817 , HG00002163 , HG00002164 , HG10011940 , HN-03781-6 , HN-08543-3 , HN-23236-9 , HN-34103-4 , HN-46140-0 , HN-62461-4 , HN-68106-4 , HN-68489-5 , HN-69805-2 , HN-78915-9 , HN-80972-2 , HN-93751-9 , HN-98875-5  
Known Ethnic Origin Of Source: Unknown
Publications
Van Sandt VST et al. Tissue Antigens 78:45-48 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKL
RGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCTGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGAGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo