Allele Report for C*03:56

C*03:56 View HGVS Report
Pre-2010 Nomenclature: Cw*0356 Local Names: HistoGenetics HIS_NEW_C_293_00191, HIS_NEW_C_293_00193
IMGT/HLA Acc No: HLA03737 OMIM Entry: *142840
Assigned: 2009-03-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ594539 , FJ594541 , GQ149300  
Cells Sequence Derived From: HN-13606-8 , HN-51959-5 , HN-61018-8  
Known Ethnic Origin Of Source: Mixed, Oriental
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGMDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLKNGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCATGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo