Allele Report for C*03:40:01

C*03:40:01 View HGVS Report
Pre-2010 Nomenclature: Cw*0340 Local Names: HLA-Cw
IMGT/HLA Acc No: HLA02881 OMIM Entry: *142840
Assigned: 2007-03-28 Sequence Last Modified: 2009-10-19
Source Entries: EF453695 , FJ600670 , FJ973625  
Cells Sequence Derived From: HN-33303-0 , SZ-105 , SZ-7  
Known Ethnic Origin Of Source: Oriental
Publications
Cheng LH et al. Tissue Antigens 72:495-7 2008. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Cw10 WHO Assigned Type: Cw3
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Cw10
Comments:
Protein Sequence (366 aa)
MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAV
LAVLGAVMAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (2894 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTG
CGGGGTTGGGAGGGAATCGGCCTCTGCGGAGAGGAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGC
AGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTC
CCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACG
CCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAG
TACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTG
ACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCTCATCCCCCACGGACGGCCCGGGTCGCCCCAAGTCTCCCGGTCTGAG
ATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAG
TTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGACGGGGCTGACCGCGGGGGCGGGGCCAGGG
TCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTA
CGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGC
GCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCCTGTGCGTGGAGTGGCTCCGCAGATAC
CTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATCTCCC
GGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGATCAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGA
GTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGA
AGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCT
TTCTCTCAGGCCTTGTTCTCTGCCTCACGCTCAATGTGTTTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCC
ACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCC
TGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTCCCCACCCCAGGTGTCCTGTCCGTTCTCAGGATGGTCACATGGG
CGCTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTCTGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGT
GACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGA
CCTGGCAGTGGGATGGGGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAG
AAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCC
CCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTGATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCA
GCCAGGTCAGGGCTGAGGCTTGGGGGTCAGGGCCCCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCAT
CCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGT
GTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTTCCACTGGGAGTTTCAAGCCCCA
GGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCA
CTTACTCTGTTGTGAAGCACATGACAATGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCA
GCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCC
CCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCT
AAGATCGCATGGCCCTGACTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCT
CAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGC
GGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTG
TAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATT
GGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTGTGATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGT
GTTCTGTAGCCTGA

IMGT/HLA

Sponsors

Animated Sponsors Logo