Allele Report for C*03:04:01:01

C*03:04:01:01 View HGVS Report
Pre-2010 Nomenclature: Cw*03040101 Local Names: Cw*03041, Cw3, C3J2
IMGT/HLA Acc No: HLA00413 OMIM Entry: *142840
Assigned: 1992-08-14 Sequence Last Modified: 1998-12-16
Source Entries: AH003186 , CR759828 , D64150 , DQ249177 , M99389 , U31372 , U31373 , U44064  
Cells Sequence Derived From: GRC-187 , GRC-212 , JD , JG , KRC-110 , MLF , PAT218 , SKA  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Oriental
Publications
Wang H et al. Tissue Antigens 49:134-40 1997. (View abstract)
Nair RP et al. Am J Hum Genet 78:827-51 2006. (View abstract)
Zarling AL et al. Immunogenetics 44:82-3 1996. (View abstract)
Sodoyer R et al. EMBO J 3:879-85 1984. (View abstract)
McCutcheon JA et al. J Exp Med 181:2085-95 1995. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 8 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: Cw10 WHO Assigned Type: Cw10(w3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 62 Cw3 [52-69%] Cw9 [0-11%] Cw10 [3-12%]
NMDP (2008) 603 Cw3 [92%] Cw10 [3%] Cw9 [1%]
13 IHWC (2002) 51 Cw10
Neural Network Assigned Type: Training - Cw3 Cw10
Comments:
Protein Sequence (366 aa)
MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAV
LAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3348 bps)
AATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCACTGGGGAGGCGC
CGCGTTGAGGATTCTCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGA
CGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGATTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTGAAGT
CCCCAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGC
TCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGGTTGGGAGGGAATCGGCCTCTGCGGAGAGGAGC
GAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGC
CCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTG
GGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGT
GGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGC
GGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCTCAT
CCCCCACGGACGGCCCGGGTCGCCCCAAGTCTCCCGGTCTGAGATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCG
ACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGG
CGGGGCTCGGGGGACGGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTG
CGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGAT
CAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTCT
CTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTG
ACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACGCTCAATGT
GTTTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCA
GAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTC
CCCACCCCAGGTGTCCTGTCCGTTCTCAGGATGGTCACATGGGCGCTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTCT
GAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTG
AGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGTGGGATGGGGAGGACCAAACTCAGGACAC
TGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGC
AGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGG
TGATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCAGGTCAGGGCTGAGGCTTGGGGGTCAGGGCCCCT
CACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTG
GCTGTCCTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGAG
TGGGGTCTGGGTTTTCTTGTTCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACCA
TCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAAGCACATGACAATGAAGGACAG
ATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACA
GACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCATA
GTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTGACTCCTCCCTGTCCCCTCAC
AGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGAG
GAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCAG
CCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGGG
TGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATTGGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTGT
GATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGGGACTGA
GATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCATCTGAATGTGT
CTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo