Allele Report for C*03:03:07

C*03:03:07 View HGVS Report
Pre-2010 Nomenclature: Cw*030307 Local Names: HIS_NEW_C_281_00138, HIS_NEW_C_229_00106, HIS_NEW_C_281_00139, HIS_NEW_C_281_00140, DE HIS_NEW_C_281_00141, HIS_NEW_C_281_00142, HIS_NEW_C_293_00185, HIS_NEW_C_335_00244, DE HIS_NEW_C_404_00412
IMGT/HLA Acc No: HLA04264 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ392222 , FJ554597 , FJ554598 , FJ554599 , FJ554600 , FJ554601 , FJ594533 , FJ619435 , FJ858906 , GQ491098 , GU128023 , HM125885 , JN123887 , JN124540  
Cells Sequence Derived From: HG00001813 , HG00002594 , HG00003341 , HN-14862-8 , HN-18083-7 , HN-22864-4 , HN-25247-5 , HN-26451-7 , HN-27728-6 , HN-35608-0 , HN-35739-3 , HN-37529-6 , HN-38356-3 , HN-98335-0  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 14 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLKNGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACGCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo