Allele Report for C*03:03:04

C*03:03:04 View HGVS Report
Pre-2010 Nomenclature: Cw*030304 Local Names: Cw*03(149740/226727)
IMGT/HLA Acc No: HLA01855 OMIM Entry: *142840
Assigned: 2004-01-31 Sequence Last Modified: 2004-04-05
Source Entries: AJ616300 , AJ616301 , AJ616302 , AJ616303 , AJ620459 , AJ620460  
Cells Sequence Derived From: 149740 , 220952 , 226727  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Common
Publications
Lebedeva TV et al. Tissue Antigens 65:101-6 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Cw9 WHO Assigned Type: Cw9(w3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 38 Cw3 [55-68%] Cw9 [8-15%]
NMDP (2008) 446 Cw3 [80%] Cw9 [6%]
13 IHWC (2002) 75 Cw9
Neural Network Assigned Type: Training - Cw3 Cw9
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEARSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLKNGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo