Allele Report for C*01:32

C*01:32 View HGVS Report
Pre-2010 Nomenclature: Cw*0132 Local Names: HIS_NEW_C_339_00288, HIS_NEW_C_339_00296, HIS_NEW_C_422_00417, HIS_NEW_C_478_00516, DE HIS_NEW_C_493_00624, HIS_NEW_C_493_00626, HIS_NEW_C_493_00631
IMGT/HLA Acc No: HLA04289 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ614610 , FJ614618 , FJ875585 , FJ976798 , FJ976875 , FJ976877 , FJ976882 , FJ997941 , GQ149303 , GQ161036 , GQ180254 , GQ180418 , GQ180420 , GQ240482 , GQ345071 , GQ401221 , GQ859570 , GU017959 , HQ590466  
Cells Sequence Derived From: HG00000951 , HN-01820-8 , HN-01902-2 , HN-05381-9 , HN-10461-1 , HN-12267-3 , HN-14507-0 , HN-29077-1 , HN-39457-9 , HN-45369-1 , HN-58910-7 , HN-59114-5 , HN-60288-7 , HN-65647-0 , HN-81436-2 , HN-81926-9 , HN-89122-6 , HN-93291-2 , HN-98676-0  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 19 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAAGTATTTCTTCACATCCGTGTCCCGGCCTGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTGTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo