Allele Report for C*01:02:08

C*01:02:08
Pre-2010 Nomenclature: Cw*010208 Local Names: HIS_NEW_C_340_00311, HIS_NEW_C_339_00266, HIS_NEW_C_339_00291, HIS_NEW_C_339_00292, DE HIS_NEW_C_355_00328, HIS_NEW_C_355_00330, HIS_NEW_C_355_00337, HIS_NEW_C_355_00349, DE HIS_NEW_C_478_00523, HIS_NEW_C_478_00527
IMGT/HLA Acc No: HLA04275 OMIM Entry: *142840
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ614588 , FJ614613 , FJ614614 , FJ618921 , FJ765745 , FJ765747 , FJ765754 , FJ765766 , FJ976805 , FJ976809 , FJ998005 , GQ180241 , GQ180248 , GQ180389 , GQ180411 , GQ240487 , GQ254390 , GQ491100 , GU128019  
Cells Sequence Derived From: HN-02906-7 , HN-05038-3 , HN-06147-1 , HN-11284-8 , HN-11354-9 , HN-12199-9 , HN-14364-7 , HN-20485-5 , HN-25237-1 , HN-35686-3 , HN-53240-0 , HN-55932-2 , HN-57785-8 , HN-72579-7 , HN-77895-3 , HN-86405-6 , HN-87701-9 , HN-91940-5 , HN-99074-6  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 19 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAAGTATTTCTTCACATCCGTGTCCCGGCCTGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTGTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACGCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo