Allele Report for C*01:02:01

C*01:02:01 View HGVS Report
Pre-2010 Nomenclature: Cw*010201 Local Names: Cw1.2, Cw1, C1J1
IMGT/HLA Acc No: HLA00401 OMIM Entry: *142840
Assigned: 1991-11-14 Sequence Last Modified: 1998-12-16
Source Entries: AJ420242 , D50852 , FJ515900 , FJ827032 , HG794388 , HM543696 , M16272 , M84171 , Z46809  
Cells Sequence Derived From: 009386 , 08009391 , AP , BRUG , H10021 , KRC-005 , LCL721 , PACO752792 , T7527 , TTY  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Oriental
Publications
Steinle A et al. Tissue Antigens 44:268-70 1994. (View abstract)
Wang H et al. Tissue Antigens 49:134-40 1997. (View abstract)
Gussow D et al. Immunogenetics 25:313-22 1987. (View abstract)
Zemmour J et al. Tissue Antigens 39:249-57 1992. (View abstract)
Cox ST et al. Tissue Antigens 61:20-48 2003. (View abstract)
Zhu F et al. Int J Immunogenet 38:281-284 2011. (View abstract)
Xu Y et al. Tissue Antigens 78:102-114 2011. (View abstract)
Xu YP et al. Tissue Antigens 75:179-181 2010. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 10 Laboratories: 8
HLA Dictionary Data
Expert Assigned Type: Cw1 WHO Assigned Type: Cw1
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 76 Cw1 [55-75%]
NMDP (2008) 260 Cw1 [92%]
13 IHWC (2002) 104 Cw1
Neural Network Assigned Type: Training - Cw1
Comments:
Protein Sequence (366 aa)
MRVMAPRTLILLLSGALALTETWACSHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAV
LAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAAGTATTTCTTCACATCCGTGTCCCGGCCTGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTGTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGATGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3349 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGTTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCACTGGGGAGGCGC
CGCGTTGAGGATTCTCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGA
CGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGT
CCCCAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGC
TCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAAC
GAGGTGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGC
CCCCAGGCTCCCACTCCATGAAGTATTTCTTCACATCCGTGTCCCGGCCTGGCCGCGGAGAGCCCCGCTTCATCTCAGTG
GGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGT
GGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGC
GGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCTCAT
CCCCCACGGACGGCCCGGGTCGCCCCAAGTCTCCCGGTCTGAGATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCG
ACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGACTGGG
GCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGGTCTCACACCCTCCAGTGGATGTGTGGCTGCGACCTG
GGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCT
GCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGA
GAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGT
ACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCCGTAGATCTCCCGGCATGGCCTCCCACGAGGAGGGGAGGAAAATGGGA
TCAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTC
TCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTT
GACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACGCTCAATG
TGTTTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTC
AGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTT
CCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTC
TGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCT
GAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGTGGGATGGGGAGGACCAAACTCAGGACA
CCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGATGGTGCCTTCTGGAGAAGAG
CAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGG
GTGATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGAGGTCAGGGCCCC
TCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCT
GGCTGTCCTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGA
GTGGGGTCTGGGTTTTCTTGTTCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACC
ATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAAGCACATGACAATGAAGGACA
GATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGAC
AGACCTTAGGAGGGCAGTTGCTTCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCAT
AGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTGCCTCCTCCCTGTCCCCTCA
CAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGA
GGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCA
GCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGG
GTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATTGGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTG
TCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGGGACTG
AGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCATCTGAATGTG
TCTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo