Allele Report for C*17:17

C*17:17 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_C_110274_04610
IMGT/HLA Acc No: HLA09031 OMIM Entry: *142840
Assigned: 2012-12-31 Sequence Last Modified: 2015-01-19
Source Entries: JX174626 , LN600061  
Cells Sequence Derived From: DKMS-LSL-C-217 , HG00005281  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (372 aa)
MRVMAPQALLLLLSGALALIETWTGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQISQRKLEAAREAEQRRAYLEGTCVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAV
LAVLAVLAVLGAVVAAVIHRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1119 bps)
ATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCTCTCGGGAGCCCTGGCCCTGATCGAGACCTGGACCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCG
GACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACGCCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAACAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCT
GCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTCCTGGCTGTC
CTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTCAGGTGGAAA
AGGAGGGAGCTGCTCTCAGGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3368 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCTGGGTCTCAAGCTCCCAGGGCCGTGTCTGCATTGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATAC
TCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTACGCAGTCCCGGTTC
TGAAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCT
CTCGGGAGCCCTGGCCCTGATCGAGACCTGGACCGGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGCG
AGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGG
GCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTG
GAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCG
GAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCAGCCCGGGGCGCAGGTCACGACCCCTCCCCATC
CCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCTCCCCGAGGCTGCGGAACCCGCCCAGACCCTCGA
CCGGAGAGAGCCCTAGTCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGGG
CGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
CGCTCCTGGACCGCGGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCGGAG
AGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGAT
CAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCCGAGTTTCCTCTGAGGGCCCCGTCTGCTCT
CTAGGACAATTAAGGGATGAAGTCCCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTG
ACCACTTTGACCACTGCGGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAATGT
GTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCA
GAGACTAGAACTTTCCAAAGAATAGGAGATTATCCCAGGTCCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTC
CCTACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCGCAAGAGAGATACAAAGTGTCT
GAATTTTCTGACTCTTCCCGTCAGAACGCCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTG
AGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAAACTCAGGACAC
CGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAAC
AGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCTGCACCCTGAGATGGAGTAAGGAGGGGGATGAGGGG
TCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGTGTAAGGGCC
CCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTC
CTGGCTGTCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTC
AGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCC
ACCTCGTTACTGGAAGCACCATCCACACCTGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAA
GCACATGACAACGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCGTGAGTCAGGG
GAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCT
GCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTG
CCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTG
ATGGCGGTGGGCGTGTGGAGGAGCTCACCTACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCT
TTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGG
GGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATCCTTTGATTGGGACGTTTCGAGTGTG
TGGTGGACTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGAC
AGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCT
GCAAAGGCATCTGAATGTGTCTGCGTTCCTGTTAGCATAATATGAGGAGTTGGAGAGACAGCTCACCCCCGTGTCCACCG
TGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo