Allele Report for C*17:03

C*17:03 View HGVS Report
Pre-2010 Nomenclature: Cw*1703 Local Names: Cw*17New
IMGT/HLA Acc No: HLA00993 OMIM Entry: *142840
Assigned: 1999-03-25 Sequence Last Modified: 2014-01-17
Source Entries: HG514458 , HG970095 , KJ562278 , LK021981 , Y18537 , Y18538 , Y18539 , Y18540 , Y18541  
Cells Sequence Derived From: 1002009 , 15090 , 17767 , 55131 , DKMS-LSL-C-155  
Known Ethnic Origin Of Source: Unknown
Publications
van der Vlies SA et al. Tissue Antigens 54:169-77 1999. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: Cw7/blank WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 C'17' [31-44%] Cw7 [10-20%]
NMDP (2008) 8 Blank [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: Not assigned
Comments:
Protein Sequence (372 aa)
MRVMAPQALLLLLSGALALIETWTGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAV
LAVLAVLAVLGAVVAAVIHRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1119 bps)
ATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCTCTCGGGAGCCCTGGCCCTGATCGAGACCTGGACCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCG
GACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGA
GTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACGCCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAACAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCT
GCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTCCTGGCTGTC
CTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTCAGGTGGAAA
AGGAGGGAGCTGCTCTCAGGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3197 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCTGGGTCTCAAGCTCCCAGGGCCGTGTCTGCATTGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATAC
TCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTACGCAGTCCCGGTTC
TGAAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCT
CTCGGGAGCCCTGGCCCTGATCGAGACCTGGACCGGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGCG
AGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGG
GCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTG
GAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCG
GAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCAGCCCGGGGCGCAGGTCACGACCCCTCCCCATC
CCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCTCCCCGAGGCTGCGGAACCCGCCCAGACCCTCGA
CCGGAGAGAGCCCTAGTCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGGG
CGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
CGCTCCTGGACCGCGGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGAT
CAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCCGAGTTTCCTCTGAGGGCCCCGTCTGCTCT
CTAGGACAATTAAGGGATGAAGTCCCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTG
ACCACTTTGACCACTGCGGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAATGT
GTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCA
GAGACTAGAACTTTCCAAAGAATAGGAGATTATCCCAGGTCCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTC
CCTACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCGCAAGAGAGATACAAAGTGTCT
GAATTTTCTGACTCTTCCCGTCAGAACGCCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTG
AGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAAACTCAGGACAC
CGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAAC
AGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCTGCACCCTGAGATGGAGTAAGGAGGGGGATGAGGGG
TCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGTGTAAGGGCC
CCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTC
CTGGCTGTCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTC
AGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCC
ACCTCGTTACTGGAAGCACCATCCACACCTGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAA
GCACATGACAACGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCGTGAGTCAGGG
GAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCT
GCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTG
CCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTG
ATGGCGGTGGGCGTGTGGAGGAGCTCACCTACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCT
TTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGG
GGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATCCTTTGATTGGGACGTTTCGAGTGTG
TGGTGGACTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGA

IMGT/HLA

Sponsors

Animated Sponsors Logo