Allele Report for C*17:01:01:03

C*17:01:01:03 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-C*17 novel allele
IMGT/HLA Acc No: HLA10025 OMIM Entry: *142840
Assigned: 2013-08-31 Sequence Last Modified: 2013-10-11
Source Entries: JX512225  
Cells Sequence Derived From: 2454  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (372 aa)
MRVMAPQALLLLLSGALALIETWAGSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DTAAQISQRKLEAAREAEQLRAYLEGECVEWLRGYLENGKETLQRAERPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLQEPCTLRWKPSSQPTIPNLGIVSGPAVLAV
LAVLAVLAVLGAVVAAVIHRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1119 bps)
ATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCTCTCGGGAGCCCTGGCCCTGATCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCG
GACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGA
GTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACGCCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAACAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCT
GCACCCTGAGATGGAAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTCCTGGCTGTC
CTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTCAGGTGGAAA
AGGAGGGAGCTGCTCTCAGGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3368 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCTGGGTCTCAAGCTCCCAGGGCCGTGTCTGCATTGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATAC
TCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTACGCAGTCCCGGTTC
TGAAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCAAGCCCTCCTCCTGCTGCT
CTCGGGAGCCCTGGCCCTGATCGAGACCTGGGCCGGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGCG
AGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGG
GCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTG
GAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCG
GAAACTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCAGCCCGGGGCGCAGGTCACGACCCCTCCCCATC
CCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCTCCCCGAGGCTGCGGAACCCGCCCAGACCCTCGA
CCGGAGAGAGCCCTAGTCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGGG
CGGGGTTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACCTGG
GGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
CGCTCCTGGACCGCGGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGAGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCGGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGAT
CAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCCGAGTTTCCTCTGAGGGCCCCGTCTGCTCT
CTAGGACAATTAAGGGATGAAGTCCCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTG
ACCACTTCGACCACTGCGGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAATGT
GTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCA
GAGACTAGAACTTTCCAAAGAATAGGAGATTATCCCAGGTCCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTC
CCTACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCGCAAGAGAGATACAAAGTGTCT
GAATTTTCTGACTCTTCCCGTCAGAACGCCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTG
AGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAAACTCAGGACAC
CGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAAC
AGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCAGGAGCCCTGCACCCTGAGATGGAGTAAGGAGGGGGATGAGGGG
TCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGTGTAAGGGCC
CCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCAACTTGGGCATCGTTTCTGGCCCAGCTGTC
CTGGCTGTCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTCGCTGCTGTGATACATAGGAGGAAGAGCTC
AGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCC
ACCTCGTTACTGGAAGCACCATCCACACCTGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTGTTGTGAA
GCACATGACAACGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCGTGAGTCAGGG
GAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCT
GCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTG
CCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTG
ATGGCGGTGGGCGTGTGGAGGAGCTCACCTACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCT
TTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGG
GGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATCCTTTGATTGGGACGTTTCGAGTGTG
TGGTGGACTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTTTTCTGTAGCCTGAGAC
AGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCT
GCAAAGGCATCTGAATGTGTCTGCGTTCCTGTTAGCATAATATGAGGAGTTGGAGAGACAGCTCACCCCCGTGTCCACCG
TGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo